BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10b13 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g28250.1 68418.m03425 Ulp1 protease family protein contains P... 30 1.6 At4g29560.1 68417.m04215 expressed protein 30 1.6 At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family... 29 2.2 At4g11070.1 68417.m01798 WRKY family transcription factor other ... 29 2.9 At2g37930.1 68415.m04656 expressed protein 27 8.8 At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing pr... 27 8.8 >At5g28250.1 68418.m03425 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 939 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 408 ASKRKNTTRSDDYESNKQPDYDMDL-SDFSITEVEATQYLTLL 533 A + N T S D ESN P Y L SDF++ + Q ++ + Sbjct: 408 ADESNNETASGDQESNPPPSYSRPLHSDFNLPSFQGDQAISTI 450 >At4g29560.1 68417.m04215 expressed protein Length = 493 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/57 (26%), Positives = 26/57 (45%) Frame = -2 Query: 346 VSNSRLSILTIDGLSTEHNSTPSFSVNKMGSPGMLVSLVSVTTNSILLVKLVTSGWN 176 +SN L D + +S P + K+GS G ++ + V+ + + LV WN Sbjct: 135 ISNLDLDSADEDSMKQVFDSVPDWLSEKLGSAGTILPWLPVSCDDVDSEMLVVDSWN 191 >At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family protein similar to SP|Q28141 ATP-dependent RNA helicase A (Nuclear DNA helicase II) (DEAD-box protein 9) {Bos taurus}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 1015 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 302 DGAQQHPLVFCKQNGFSGNACVISFSDHKLHFVSKISNKW 183 DG+ PL+ G C++ F D +HF S I+N++ Sbjct: 799 DGSSTSPLLDLFPTSSEG--CILVFDDSDMHFTSSIANRY 836 >At4g11070.1 68417.m01798 WRKY family transcription factor other putative proteins, Arabidopsis thaliana Length = 313 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -2 Query: 346 VSNSRLSILTIDGLSTEHNSTPSFSVNKMGSPGMLV-SLVSVTTN 215 VS+ + +IL ++G +T+HN T + + + PG + S S+T N Sbjct: 53 VSSFKKAILMLNGSTTQHNPTIELAPDPLAHPGKVPGSPASITGN 97 >At2g37930.1 68415.m04656 expressed protein Length = 467 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +3 Query: 168 HNRFHPLVTNFTNKMEFVVTETNDTSI-PGEPILF 269 H HP V +M+ V T T+D+SI E +LF Sbjct: 270 HKNEHPFVHTIIGEMKTVTTFTSDSSIHKSETVLF 304 >At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing protein contains Pfam profile PF01429: Methyl-CpG binding domain Length = 384 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +3 Query: 330 SREFD---TEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNK 458 S+E+D TEA N END KT A+ ++N T+ D + + Sbjct: 302 SKEYDEKTTEAEANKENDTQESDEKKTEAAANKENETQESDVKKTE 347 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,944,086 Number of Sequences: 28952 Number of extensions: 271102 Number of successful extensions: 769 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -