BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10b11 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 25 0.70 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 2.8 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.7 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 4.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 4.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 4.9 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 25.0 bits (52), Expect = 0.70 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 275 SVSLGGVMSKFLILYGPVFICAL 207 S +LG +MS F++ + P F+ AL Sbjct: 371 STTLGIIMSAFIVCWLPFFVLAL 393 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 559 KELVKRQNNNHFAYH 603 K K QNNNH+ H Sbjct: 112 KNQYKNQNNNHYTSH 126 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/50 (24%), Positives = 20/50 (40%) Frame = +1 Query: 475 GEELIDRWGSDSEECFRDNEGRGQWVKGKELVKRQNNNHFAYHTCNKSWR 624 GE L DR GS+S + + + + E + N Y + W+ Sbjct: 423 GEGLADRRGSESSDSVLLSPEASKATEAVEFIAEHLRNEDLYIQTREDWK 472 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 310 DYNENVIIGYKGYYQAYAYNGGSL 381 DY + + GY+G + A+NGG + Sbjct: 229 DYPD-IYSGYEGALRCLAHNGGEI 251 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 310 DYNENVIIGYKGYYQAYAYNGGSL 381 DY + + GY+G + A+NGG + Sbjct: 229 DYPD-IYSGYEGALRCLAHNGGEI 251 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 310 DYNENVIIGYKGYYQAYAYNGGSL 381 DY + + GY+G + A+NGG + Sbjct: 229 DYPD-IYSGYEGALRCLAHNGGEI 251 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,036 Number of Sequences: 438 Number of extensions: 3648 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -