BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10b07 (720 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC011481-1|AAH11481.1| 112|Homo sapiens Unknown (protein for IM... 34 0.45 U08854-1|AAC50077.1| 530|Homo sapiens UDP glucuronosyltransfera... 30 9.6 AF548389-1|AAN40695.1| 530|Homo sapiens UDP-glucuronosyltransfe... 30 9.6 AF180322-1|AAD55093.1| 530|Homo sapiens UDP-glucuronosyltransfe... 30 9.6 AF179404-1|AAF25010.1| 135|Homo sapiens UDP-glucuronosyltransfe... 30 9.6 >BC011481-1|AAH11481.1| 112|Homo sapiens Unknown (protein for IMAGE:4151212) protein. Length = 112 Score = 34.3 bits (75), Expect = 0.45 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -2 Query: 575 PRRLPCQSFPPNRSQARFGLRAQDRTGGQTPTHNRQTLPRQLNQTSGCW 429 P+R+P Q P + AR G RA R P H +P + + + W Sbjct: 36 PQRIPAQRLVPQQPHARRGCRAGQRPVAAAPAHGAHVIPAEGHGPAAEW 84 >U08854-1|AAC50077.1| 530|Homo sapiens UDP glucuronosyltransferase precursor protein. Length = 530 Score = 29.9 bits (64), Expect = 9.6 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +2 Query: 41 KMTILCWLALLSTLTAVNAVNILAVFPTPAYSHHIVYKVYIEALAEKCHNVTVV 202 K T + L LS + + + V+PT YSH I K +E L ++ H VTV+ Sbjct: 4 KWTSVFLLIQLSCYFSSGSCGKVLVWPTE-YSHWINMKTILEELVQRGHEVTVL 56 >AF548389-1|AAN40695.1| 530|Homo sapiens UDP-glucuronosyltransferase protein. Length = 530 Score = 29.9 bits (64), Expect = 9.6 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +2 Query: 41 KMTILCWLALLSTLTAVNAVNILAVFPTPAYSHHIVYKVYIEALAEKCHNVTVV 202 K T + L LS + + + V+PT YSH I K +E L ++ H VTV+ Sbjct: 4 KWTSVFLLIQLSCYFSSGSCGKVLVWPTE-YSHWINMKTILEELVQRGHEVTVL 56 >AF180322-1|AAD55093.1| 530|Homo sapiens UDP-glucuronosyltransferase 2B15 protein. Length = 530 Score = 29.9 bits (64), Expect = 9.6 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +2 Query: 41 KMTILCWLALLSTLTAVNAVNILAVFPTPAYSHHIVYKVYIEALAEKCHNVTVV 202 K T + L LS + + + V+PT YSH I K +E L ++ H VTV+ Sbjct: 4 KWTSVFLLIQLSCYFSSGSCGKVLVWPTE-YSHWINMKTILEELVQRGHEVTVL 56 >AF179404-1|AAF25010.1| 135|Homo sapiens UDP-glucuronosyltransferase UGT2B15 protein. Length = 135 Score = 29.9 bits (64), Expect = 9.6 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +2 Query: 41 KMTILCWLALLSTLTAVNAVNILAVFPTPAYSHHIVYKVYIEALAEKCHNVTVV 202 K T + L LS + + + V+PT YSH I K +E L ++ H VTV+ Sbjct: 4 KWTSVFLLIQLSCYFSSGSCGKVLVWPTE-YSHWINMKTILEELVQRGHEVTVL 56 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,559,071 Number of Sequences: 237096 Number of extensions: 2403124 Number of successful extensions: 4287 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4287 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8455186714 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -