BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10b02 (547 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31444| Best HMM Match : No HMM Matches (HMM E-Value=.) 204 4e-53 SB_56015| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.35 SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 1.9 SB_16484| Best HMM Match : MSG (HMM E-Value=0.24) 29 2.5 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) 29 3.3 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_27754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_21731| Best HMM Match : Ribosomal_L13e (HMM E-Value=7.2) 28 5.7 SB_5693| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50053| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_49262| Best HMM Match : Virus_P-coat (HMM E-Value=1.8) 27 7.6 SB_40034| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_4921| Best HMM Match : Myosin_head (HMM E-Value=7.39998e-41) 27 7.6 >SB_31444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 204 bits (498), Expect = 4e-53 Identities = 96/132 (72%), Positives = 116/132 (87%) Frame = +1 Query: 52 MKFNKQVTSSRRKNRKRHFSAPSHIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQVVRG 231 MK N +V+SSRRK+RK HFSAPS +RR LMS+PLSKELRQK+NV+S+P+RKDDEVQV RG Sbjct: 1 MKRNSEVSSSRRKSRKAHFSAPSSVRRKLMSAPLSKELRQKYNVRSIPVRKDDEVQVTRG 60 Query: 232 HYKGQQVGKVMQVYRKKFVVYIERIQREKANGATAYVGIHPSKCVIVKLKMNKDRKAILD 411 H+K QQVGKV+QVYRKK+V++I+RIQREKANGAT VGIHPSK IVKLK++KDRK ILD Sbjct: 61 HFKSQQVGKVIQVYRKKWVIHIDRIQREKANGATVSVGIHPSKVEIVKLKIDKDRKKILD 120 Query: 412 RRAKGRLAALGK 447 R+ + +LA GK Sbjct: 121 RKNRSKLAEKGK 132 >SB_56015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.35 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +1 Query: 52 MKFNKQVTSSRRKNRKRHFSAPSHIRRVLMSSPLSKELRQKFNVKSMP--IRK 204 MK + Q+ RK+ K H P HIR+ S + K +R+ N + P IRK Sbjct: 1 MKTHSQIQKHTRKS-KTHSQIPKHIRKSKTHSQIQKHIRKSKNTLANPKHIRK 52 >SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4248 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +3 Query: 324 WCNSICRHSPFKVCDCQVEDE*RPQSNPRSQSKGQTGCTWQRQG*IHRGNCHSHG 488 W N IC ++C C+V DE N + ++ G TW R +R + G Sbjct: 525 WHNRICMR--VEICGCKVCDEPLGMENSKIKANDIEGHTWTRNREPYRARLNYRG 577 >SB_16484| Best HMM Match : MSG (HMM E-Value=0.24) Length = 661 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 498 LRGLHGCGSFLGVFTLVFAKCSQS 427 L GLH CG + VFAKC Q+ Sbjct: 72 LVGLHPCGDLVPTMLKVFAKCDQA 95 >SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 36 GEERQNEVQQAGDFLKK--EKQEEAFQCSFTYKASVDVLSPV*GTKTKIQ 179 G E++ +A ++ KK E + F C Y +V + GTKTKIQ Sbjct: 163 GNEKKKFTYEALEYAKKSVELDDRDFACHKWYAITVSNVGDFEGTKTKIQ 212 >SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) Length = 828 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -1 Query: 415 CDRGLLCGLYSSST*QSHTLKGE-CRHMLLHHWP--FLFESSQCIQQTFYD 272 C G + + ST + L+G+ CR M+L HWP F + + + +T D Sbjct: 325 CKNGKVPVVSGGSTYDTWPLQGDFCRTMMLLHWPNWFSLDELESVDETSKD 375 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 28.3 bits (60), Expect = 4.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 27 CRFGEERQNEVQQAGDFLKKEKQEEAFQCSFTY 125 C F EER QQ G K E+ ++AF + Y Sbjct: 2583 CPFTEERMESFQQIGRTAKSEESDKAFGFNTIY 2615 >SB_27754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = -2 Query: 318 LFSLNPLNVYNKLFTIHLHHFANLLAFVVSTYNLNFIVFAN 196 L +++ ++YN+L +H+ H N L V T+ N +V A+ Sbjct: 338 LVAVHVTHLYNRLVAVHVTHLYNRLVAVHVTHLYNRLVAAH 378 >SB_21731| Best HMM Match : Ribosomal_L13e (HMM E-Value=7.2) Length = 606 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +1 Query: 58 FNKQVTSSRRKNRKRHFSAPSHIRRVLMSSPLSKELRQKFNVKSMPIRKDD 210 F+ S +K+ +R+F +HI + + +S SK+ ++ K + DD Sbjct: 124 FSTSQASRPKKSNRRYFPTSNHIAKAISASRYSKDDQESLKRKVEEWQTDD 174 >SB_5693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1429 Score = 27.9 bits (59), Expect = 5.7 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +3 Query: 24 PCRFGEERQNEVQQAGDFLKKEKQEEAFQCSFTYKASVDVLSP 152 PCRFGE N++ F + + A CSF + SP Sbjct: 1239 PCRFGEAPDNKIASPCRFGEAPDNKIASPCSFGEAPDNKIASP 1281 >SB_50053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 959 Score = 27.5 bits (58), Expect = 7.6 Identities = 15/56 (26%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Frame = +1 Query: 118 SHIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQ--VVRGHYKGQQVGKVMQVYRK 279 + ++++ + + K LR+ K+MP R+D+++Q V YK ++VG+ + R+ Sbjct: 139 NEVKQLGNGNNMEKILREFIKKKNMPKREDEKLQGNVSGRDYKNKKVGQKSEEQRE 194 >SB_49262| Best HMM Match : Virus_P-coat (HMM E-Value=1.8) Length = 586 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 111 CSFTYKASVDVLSPV*GTKTKIQCKIHAYSQR 206 CS K ++ L+ + GT KI+ K HA+S++ Sbjct: 72 CSCKTKTELNALNELLGTDEKIEKKSHAWSEK 103 >SB_40034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 456 TLVFAKCSQSALCSAIEDCFAVFI 385 T+ + C + + CS I DCF VFI Sbjct: 221 TMPLSFCQKFSSCSVIIDCFEVFI 244 >SB_4921| Best HMM Match : Myosin_head (HMM E-Value=7.39998e-41) Length = 1017 Score = 27.5 bits (58), Expect = 7.6 Identities = 29/126 (23%), Positives = 55/126 (43%), Gaps = 1/126 (0%) Frame = +1 Query: 10 ISVLSRVVLAKSDRMKFNKQVTSSRRKNRKRHFSAPSHIRRVLMSSPLSKELRQKFNVKS 189 IS +S + S ++ K VTS + N K S+ + + S +SK NVKS Sbjct: 524 ISKISNIKSVTSGKITNIKSVTSGKISNIKSVTSSKISNIQSVTSGKISKMKSVTSNVKS 583 Query: 190 MPIRKDDEVQVVRGHYKGQQVGKVMQVYRK-KFVVYIERIQREKANGATAYVGIHPSKCV 366 + K ++ K Q + ++ K R+Q ++GA+A++ + P++ Sbjct: 584 VTSGKISNIKSALPRVKYQSPSPLHRLDGKHPRSPRRIRVQTGVSSGASAHLNVKPTEYA 643 Query: 367 IVKLKM 384 + K+ Sbjct: 644 YGRTKI 649 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,361,455 Number of Sequences: 59808 Number of extensions: 358339 Number of successful extensions: 1123 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1123 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -