BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10a22 (397 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.7 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 1.7 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.7 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.7 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 1.7 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 3.9 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 5.1 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.6 bits (46), Expect = 1.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 270 YTIRCIKTVGDVVLKREEVEPMDTDGPTSSDSE*NMLLS 386 +TI CI T+ ++ E + DG + + N+LLS Sbjct: 33 FTILCILTLALTLVTLVRAEDIFEDGKSDKEILDNLLLS 71 Score = 21.0 bits (42), Expect = 5.1 Identities = 5/12 (41%), Positives = 11/12 (91%) Frame = -1 Query: 271 YLLKSHILLNCE 236 YL++ H++L+C+ Sbjct: 176 YLMRRHLILSCQ 187 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.6 bits (46), Expect = 1.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 270 YTIRCIKTVGDVVLKREEVEPMDTDGPTSSDSE*NMLLS 386 +TI CI T+ ++ E + DG + + N+LLS Sbjct: 33 FTILCILTLALTLVTLVRAEDIFEDGKSDKEILDNLLLS 71 Score = 21.0 bits (42), Expect = 5.1 Identities = 5/12 (41%), Positives = 11/12 (91%) Frame = -1 Query: 271 YLLKSHILLNCE 236 YL++ H++L+C+ Sbjct: 176 YLMRRHLILSCQ 187 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.6 bits (46), Expect = 1.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 270 YTIRCIKTVGDVVLKREEVEPMDTDGPTSSDSE*NMLLS 386 +TI CI T+ ++ E + DG + + N+LLS Sbjct: 33 FTILCILTLALTLVTLVRAEDIFEDGKSDKEILDNLLLS 71 Score = 21.0 bits (42), Expect = 5.1 Identities = 5/12 (41%), Positives = 11/12 (91%) Frame = -1 Query: 271 YLLKSHILLNCE 236 YL++ H++L+C+ Sbjct: 227 YLMRRHLILSCQ 238 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.6 bits (46), Expect = 1.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 270 YTIRCIKTVGDVVLKREEVEPMDTDGPTSSDSE*NMLLS 386 +TI CI T+ ++ E + DG + + N+LLS Sbjct: 33 FTILCILTLALTLVTLVRAEDIFEDGKSDKEILDNLLLS 71 Score = 21.0 bits (42), Expect = 5.1 Identities = 5/12 (41%), Positives = 11/12 (91%) Frame = -1 Query: 271 YLLKSHILLNCE 236 YL++ H++L+C+ Sbjct: 176 YLMRRHLILSCQ 187 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.6 bits (46), Expect = 1.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 105 LSCSAAGRRSLRLDSI 58 + C GRR LRLD+I Sbjct: 215 IGCLTLGRRILRLDAI 230 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 3.9 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 391 FYDNNIFYSESEDVGPSVSMGSTSSR 314 F +NN+ Y SED+ + S+ S+ Sbjct: 286 FGENNVQYQGSEDILNTQSLAKAVSK 311 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.0 bits (42), Expect = 5.1 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -1 Query: 391 FYDNNIFYSESEDVGPSVSMGSTSSR 314 + +NN+ Y S+D+ + S G S+ Sbjct: 291 YEENNVQYEGSQDILNTQSFGKVVSK 316 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,579 Number of Sequences: 438 Number of extensions: 1712 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9761793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -