BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10a21 (692 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 26 0.30 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 2.1 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 4.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.4 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 26.2 bits (55), Expect = 0.30 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Frame = +1 Query: 250 YRGNTQISFKQ*S*KLLSTTGILYNGCFNN------EKHMPRRKTSDNMVYANRLYIFHI 411 Y G I Q S K++S G+L+ G NN +H P ++ + +MV N + I Sbjct: 296 YEGIQDIFNTQSSAKVMSKNGVLFFGLVNNSAIGCWNEHQPLQRQNMDMVAQNEKTLQMI 355 Query: 412 I 414 I Sbjct: 356 I 356 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 120 NQINNTKLLKSNNQ 79 N I NT+ KSNNQ Sbjct: 410 NLIKNTRCAKSNNQ 423 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 6/39 (15%) Frame = +1 Query: 292 KLLSTTGILYNGCFNN------EKHMPRRKTSDNMVYAN 390 K++S G+L+ G NN +H P ++ + +MV N Sbjct: 310 KIMSKNGVLFFGLMNNSAIGCWNEHQPLQRENMDMVAQN 348 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 181 NEYL**IVNKYMKIKN 228 NEY+ + NKY KI N Sbjct: 370 NEYIWIVSNKYQKIAN 385 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 6.4 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 Query: 627 STPWCCRC 650 S PW CRC Sbjct: 923 SNPWSCRC 930 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,904 Number of Sequences: 438 Number of extensions: 4238 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -