BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10a20 (755 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) 29 4.1 SB_41864| Best HMM Match : Tropomyosin (HMM E-Value=0.17) 29 5.4 SB_23062| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.3 bits (65), Expect = 1.8 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +3 Query: 420 KCIKMKRVKCNKVR-TVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYM 596 K + KR K++ T E+V +K +K + L + +LK L E Y+ LK K L KY+ Sbjct: 68 KSAEAKRESKKKIKETERELV---QKGKKPFYLRKSELKKLELAEKYKELKSKGKLQKYL 124 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 29.1 bits (62), Expect = 4.1 Identities = 21/83 (25%), Positives = 39/83 (46%) Frame = +3 Query: 402 KANVVDKCIKMKRVKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLA 581 +A + +KC ++ V+ K V+ I DEK+ + + E L +L+S + +++ Sbjct: 979 QAQLEEKCTELGNVESEKQYLVSMINERDEKLYEIQDSFEAQLLDLTSSRDND---VEIL 1035 Query: 582 LSKYMAMLSTLEMTQPLLEIFRN 650 S+ +M L Q E RN Sbjct: 1036 RSEQESMHQVLTERQQECETLRN 1058 >SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) Length = 1293 Score = 29.1 bits (62), Expect = 4.1 Identities = 21/83 (25%), Positives = 39/83 (46%) Frame = +3 Query: 402 KANVVDKCIKMKRVKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLA 581 +A + +KC ++ V+ K V+ I DEK+ + + E L +L+S + +++ Sbjct: 927 QAQLEEKCTELGNVESEKQYLVSMINERDEKLYEIQDSFEAQLLDLTSSRDND---VEIL 983 Query: 582 LSKYMAMLSTLEMTQPLLEIFRN 650 S+ +M L Q E RN Sbjct: 984 RSEQESMHQVLTERQQECETLRN 1006 >SB_41864| Best HMM Match : Tropomyosin (HMM E-Value=0.17) Length = 227 Score = 28.7 bits (61), Expect = 5.4 Identities = 34/127 (26%), Positives = 57/127 (44%), Gaps = 9/127 (7%) Frame = +3 Query: 324 YTSKRDRFYESFKRYHAS*SLYEHASKANVVD-------KCIKMKRVKCNKVRTVTEIVN 482 YT +R+ + + +RY + L E K N +D K+ K N V+ + E+ Sbjct: 59 YTKERE--FVATRRYEENMKLCETLKK-NKIDVPGYEEKTADKLSEAK-NIVKDIAEVNK 114 Query: 483 S-DEKIQKTYELAEFDLKNLSSLESY-ETLKIKLALSKYMAMLSTLEMTQPLLEIFRNKA 656 +EK K Y+L L+ L+ ++ Y ETL+ + K + T + Q EI + Sbjct: 115 KIEEKKAKLYDLERRHLRALNKIDHYEETLRASEQIGKRVVTNYTPKSDQEYQEIISDLR 174 Query: 657 DTRQIAA 677 D + AA Sbjct: 175 DGIKHAA 181 >SB_23062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 27.9 bits (59), Expect = 9.4 Identities = 17/68 (25%), Positives = 36/68 (52%) Frame = +3 Query: 525 DLKNLSSLESYETLKIKLALSKYMAMLSTLEMTQPLLEIFRNKADTRQIAAVVFSTLAFI 704 + KN+SS Y T K K +L++ + + + + PL+E+FR + ++ + + + + Sbjct: 275 ETKNMSSF--YWTKKYKKSLARSLREAAVIHLGVPLVELFRYLSGQHRVHCLPSNASSGL 332 Query: 705 HNRFHPLV 728 +R P V Sbjct: 333 ASRPVPFV 340 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,742,758 Number of Sequences: 59808 Number of extensions: 356819 Number of successful extensions: 731 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -