BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10a20 (755 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 1.9 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 25 1.9 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.7 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.4 bits (53), Expect = 1.9 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 560 NSEN*IGAQQIHGYAQHPGNDPAAVGNI*KQSRHSANCRR 679 NS N + Q H QH + P+AV N +RH++ RR Sbjct: 820 NSTNSAYSMQSHQQQQH--HQPSAVSNSNGLARHNSKSRR 857 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 25.4 bits (53), Expect = 1.9 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 669 IAAVVFSTLAFIHNRFH 719 + A+V S LA+IH R+H Sbjct: 9 VLAIVLSCLAWIHRRYH 25 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 546 NCLDFLNQIRPIRRFFGSFHRCLQFR 469 NC++F + +PIRR+ HR +Q++ Sbjct: 1144 NCIEFALKAKPIRRYIPK-HR-IQYK 1167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 687,824 Number of Sequences: 2352 Number of extensions: 12226 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -