BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10a15 (686 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC038225-1|AAH38225.1| 1101|Homo sapiens structural maintenance ... 31 5.1 AL162390-1|CAH73243.1| 1101|Homo sapiens structural maintenance ... 31 5.1 AJ310550-1|CAC39247.1| 1101|Homo sapiens SMC5 protein protein. 31 5.1 AB011166-1|BAA25520.2| 1120|Homo sapiens KIAA0594 protein protein. 31 5.1 >BC038225-1|AAH38225.1| 1101|Homo sapiens structural maintenance of chromosomes 5 protein. Length = 1101 Score = 30.7 bits (66), Expect = 5.1 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 67 RLPLEIIDTILQYLDPISHAKVVGLTTRVKCRLLRDNNVEDYLKLTP 207 R P ++D I Q +DPI+ +V + C+ N Y +TP Sbjct: 1012 RCPFRVVDEINQGMDPINERRVFEMVVNTACK----ENTSQYFFITP 1054 >AL162390-1|CAH73243.1| 1101|Homo sapiens structural maintenance of chromosomes 5 protein. Length = 1101 Score = 30.7 bits (66), Expect = 5.1 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 67 RLPLEIIDTILQYLDPISHAKVVGLTTRVKCRLLRDNNVEDYLKLTP 207 R P ++D I Q +DPI+ +V + C+ N Y +TP Sbjct: 1012 RCPFRVVDEINQGMDPINERRVFEMVVNTACK----ENTSQYFFITP 1054 >AJ310550-1|CAC39247.1| 1101|Homo sapiens SMC5 protein protein. Length = 1101 Score = 30.7 bits (66), Expect = 5.1 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 67 RLPLEIIDTILQYLDPISHAKVVGLTTRVKCRLLRDNNVEDYLKLTP 207 R P ++D I Q +DPI+ +V + C+ N Y +TP Sbjct: 1012 RCPFRVVDEINQGMDPINERRVFEMVVNTACK----ENTSQYFFITP 1054 >AB011166-1|BAA25520.2| 1120|Homo sapiens KIAA0594 protein protein. Length = 1120 Score = 30.7 bits (66), Expect = 5.1 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 67 RLPLEIIDTILQYLDPISHAKVVGLTTRVKCRLLRDNNVEDYLKLTP 207 R P ++D I Q +DPI+ +V + C+ N Y +TP Sbjct: 1031 RCPFRVVDEINQGMDPINERRVFEMVVNTACK----ENTSQYFFITP 1073 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,781,036 Number of Sequences: 237096 Number of extensions: 1732121 Number of successful extensions: 3213 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3213 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -