BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10a15 (686 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276482-1|CAB81549.1| 769|Drosophila melanogaster putative Sec... 30 3.4 >AJ276482-1|CAB81549.1| 769|Drosophila melanogaster putative Sec23 protein protein. Length = 769 Score = 29.9 bits (64), Expect = 3.4 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 5/89 (5%) Frame = +1 Query: 40 TKRARAKRIRLPLEIIDTILQY---LDPISHAKVVGLTTRVKCRLLRDNNVE-DY-LKLT 204 + R A R+ +PL + L+ L PI + V L TR CR + + + DY KL Sbjct: 26 SSRIEASRLVVPLACLYQPLKERPDLPPIQYEPV--LCTRSNCRAILNPLCQVDYRAKLW 83 Query: 205 PANYHFTTDQFICNYLGITDHPMTPYLVP 291 N+ F +QF Y I++ L+P Sbjct: 84 VCNFCFQRNQFPPQYAAISEQHQPAELIP 112 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,124,549 Number of Sequences: 53049 Number of extensions: 558337 Number of successful extensions: 1457 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1457 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 3013199100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -