BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10a11 (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.2 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 24 1.6 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 24 1.6 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = +2 Query: 473 EYRLIVENLSSRISWQDLKDYMRQAGEVTYADAHKQHRNEGVVEFATH 616 E+ L + NL + + + + G ++ +QH EGV E H Sbjct: 1039 EHHLQIMNLKTYTQYSVVVQAFNKVGSGPMSEERRQHTAEGVPEQPPH 1086 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -2 Query: 331 FSI*LVHSIICISVIFKF-NKTIS 263 FSI +HSI I +IF + N+TI+ Sbjct: 5 FSIMFIHSIFLILIIFIYSNETIA 28 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -2 Query: 331 FSI*LVHSIICISVIFKF-NKTIS 263 FSI +HSI I +IF + N+TI+ Sbjct: 5 FSIMFIHSIFLILIIFIYSNETIA 28 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,401 Number of Sequences: 438 Number of extensions: 3293 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -