SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt9e24
         (590 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    25   0.36 
DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc gr...    22   4.5  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 25.4 bits (53), Expect = 0.36
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = -1

Query: 590 PEHEGILGHPDFGRSVVQEQSDETHRHHQLTHQDRVHLSDESPAYRFFSEI 438
           P+ + +LG P FGRS   + ++ET     +    R     ++P +  + EI
Sbjct: 409 PKSKIVLGVPFFGRSFTLQFTNETQVGAPIKGPGREGFYTQNPGFLAYFEI 459


>DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc
           growth factor 4 protein.
          Length = 431

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 8/10 (80%), Positives = 10/10 (100%)
 Frame = -3

Query: 72  NFFSQLKHKI 43
           +FFS+LKHKI
Sbjct: 163 SFFSKLKHKI 172


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,749
Number of Sequences: 336
Number of extensions: 2764
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14830622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -