SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt9b03
         (741 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT030141-1|ABN49280.1|  374|Drosophila melanogaster IP17450p pro...    29   5.0  

>BT030141-1|ABN49280.1|  374|Drosophila melanogaster IP17450p
           protein.
          Length = 374

 Score = 29.5 bits (63), Expect = 5.0
 Identities = 17/64 (26%), Positives = 26/64 (40%)
 Frame = +1

Query: 490 LFLTILLGFYFTILQAYEYIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRH 669
           +FL +      T    YEY E  F  + R+ GS FF       + ++I    L    +  
Sbjct: 215 IFLPVFCNLQLT--STYEYFEMRFNKSVRLLGSAFFTGANLIWLPIVIYVPALAFNQVTG 272

Query: 670 LNNH 681
           +N H
Sbjct: 273 INIH 276


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,007,758
Number of Sequences: 53049
Number of extensions: 340749
Number of successful extensions: 685
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 681
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 685
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3355404063
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -