SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt9a15
         (554 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_05_0494 - 24898268-24898576,24898674-24898781,24900428-249005...    29   2.5  

>03_05_0494 -
           24898268-24898576,24898674-24898781,24900428-24900515,
           24900839-24900975,24901396-24901716
          Length = 320

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 20/65 (30%), Positives = 29/65 (44%)
 Frame = +1

Query: 10  GFSKVPELHIKRLVTAESIHCVLKICKNSKPRSYLKYEYFKTFLCFYCGNVSGVM*YSRS 189
           GF +   LH       E++ C   +CK      Y  YEYF  F+  YCG  S ++  S +
Sbjct: 134 GFLRANSLHSD----IEALFCGYWLCK------YATYEYFGDFVILYCGEGSLLVFLSPA 183

Query: 190 SKNTY 204
           +   Y
Sbjct: 184 TAGGY 188


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,881,264
Number of Sequences: 37544
Number of extensions: 204738
Number of successful extensions: 355
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 349
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 355
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1257681096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -