Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt7o15
         (230 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          21   2.6  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      21   2.6  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    21   2.6  
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    20   3.5  
DQ667194-1|ABG75746.1|  391|Apis mellifera cys-loop ligand-gated...    19   8.0  

>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 20.6 bits (41), Expect = 2.6
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -1

Query: 116 MPLHLLKYIQI 84
           +PLH+ KY+Q+
Sbjct: 315 VPLHMQKYVQM 325


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 20.6 bits (41), Expect = 2.6
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -1

Query: 116 MPLHLLKYIQI 84
           +PLH+ KY+Q+
Sbjct: 315 VPLHMQKYVQM 325


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 20.6 bits (41), Expect = 2.6
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = -1

Query: 224 F*STIIY*FDSILIANKYTSQYKIHHINLKLILATNM 114
           F + +I  FD+IL  NK+    KI  I    + A+ +
Sbjct: 816 FLNEVISDFDAILDQNKFKDIIKIKTIGSTYMAASGI 852


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 20.2 bits (40), Expect = 3.5
 Identities = 8/24 (33%), Positives = 12/24 (50%)
 Frame = -1

Query: 179 NKYTSQYKIHHINLKLILATNMPL 108
           N Y + YK  H N+  I    +P+
Sbjct: 325 NNYNNNYKPLHYNINYIEQIPVPV 348


>DQ667194-1|ABG75746.1|  391|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 391

 Score = 19.0 bits (37), Expect = 8.0
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +1

Query: 154 ILYWEVYLF 180
           ILYW + LF
Sbjct: 379 ILYWPILLF 387


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 53,938
Number of Sequences: 438
Number of extensions: 976
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 46
effective length of database: 126,195
effective search space used:  3785850
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 36 (19.4 bits)