Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt7e08
         (684 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    22   4.1  

>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%)
 Frame = +1

Query: 310 ESQLAELHAQNEEIEDDLQ-LTEDAKLRLEVNMQAMRAQFERDLQAKEEQGEEK 468
           +++  E H   E ++   Q +    KL +E   +   +  E + + KEE+GE+K
Sbjct: 187 QTEFLEEHKIKEIVKKHSQFIGYPIKLVVEKEREKELSDDEAEEEKKEEEGEDK 240


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.306    0.123    0.303 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 65,851
Number of Sequences: 336
Number of extensions: 820
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17906060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.6 bits)