BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmmt7c07
(371 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 2.0
>DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine
receptor beta2subunit protein.
Length = 427
Score = 22.2 bits (45), Expect = 2.0
Identities = 17/70 (24%), Positives = 31/70 (44%)
Frame = +1
Query: 49 RNMGIYSLNKLLLRYNLRSFLCLI*FIPNLSTYGLNYIYLNFRQILFKNIDIGWREIYRG 228
R+ + S + L L + + ++ ST + LNF LF +D+ WR + G
Sbjct: 241 RHYSMNSTTYVTLTIVLMTMTLMTLWLEPSSTERMIIANLNFILHLFCLLDVQWRIPFNG 300
Query: 229 KGIFNILKNY 258
+ N++ Y
Sbjct: 301 IQMPNLMVFY 310
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 48,871
Number of Sequences: 438
Number of extensions: 874
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used: 8928360
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)
- SilkBase 1999-2023 -