SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt6g02
         (691 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ069332-1|AAZ32217.1|  296|Apis mellifera RNA polymerase II lar...    26   0.39 
DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex det...    24   1.6  
EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.          22   6.3  
EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.      22   6.3  

>DQ069332-1|AAZ32217.1|  296|Apis mellifera RNA polymerase II large
           subunit protein.
          Length = 296

 Score = 25.8 bits (54), Expect = 0.39
 Identities = 17/60 (28%), Positives = 28/60 (46%)
 Frame = +1

Query: 445 EVPKDTKLYSELLVTLIVQALFQLMEPTVTIRVRQTDKALVESLLGKAQQDYXNKIKKDV 624
           E+ K  K   E ++ +I +A    +EPT    +RQT +  V  +L  A+       KK +
Sbjct: 162 EIQKXIKKAKEDVIEVIQKAHNMELEPTPGNTLRQTFENQVNRILNDARDKTGGSAKKSL 221


>DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 4/25 (16%)
 Frame = -1

Query: 259 FRC*TPPRPSHRFLRP----FRWPL 197
           FRC  PP P  RF+ P    FR PL
Sbjct: 148 FRCIGPPTPFPRFIPPNAYRFRPPL 172


>EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.
          Length = 686

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 654 VARHLWWYRAG 686
           V + LWWY+ G
Sbjct: 78  VQKFLWWYKQG 88


>EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.
          Length = 686

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 654 VARHLWWYRAG 686
           V + LWWY+ G
Sbjct: 78  VQKFLWWYKQG 88


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 162,863
Number of Sequences: 438
Number of extensions: 2920
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21073995
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -