Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt5d20
         (117 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    20   2.4  
AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.       19   7.3  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    18   9.7  

>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 20.2 bits (40), Expect = 2.4
 Identities = 9/31 (29%), Positives = 17/31 (54%)
 Frame = +1

Query: 16  SICAAGMKALMSYFSKKDEFLIKLFAVLYCL 108
           +IC   +   MS  S+  +F+I ++ +  CL
Sbjct: 155 AICHPFISHTMSKLSRAVKFIIVIWLLALCL 185


>AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.
          Length = 349

 Score = 18.6 bits (36), Expect = 7.3
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +3

Query: 15  FNLRSRNESS 44
           FN+R RN++S
Sbjct: 319 FNIRDRNKTS 328


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
          isoform A protein.
          Length = 969

 Score = 18.2 bits (35), Expect = 9.7
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +3

Query: 21 LRSRNESSHVI 53
          LR+RN+  HV+
Sbjct: 13 LRNRNQLQHVL 23


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,391
Number of Sequences: 438
Number of extensions: 349
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 19
effective length of database: 138,021
effective search space used:  2622399
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (18.9 bits)