SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt5d03
         (672 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    25   0.66 
DQ666693-1|ABG29167.1|  250|Apis mellifera MAX dimerization prot...    25   0.87 
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    21   8.1  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    21   8.1  
DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex det...    21   8.1  
DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex det...    21   8.1  
DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex det...    21   8.1  
DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex det...    21   8.1  
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    21   8.1  

>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 25.0 bits (52), Expect = 0.66
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%)
 Frame = -1

Query: 669 ALFSPSTSAYIVLKPNTLRKYHEADDT-HEASRY 571
           A+ S +T  Y+V   NTL  Y  ADD+ H  S +
Sbjct: 194 AMDSTNTMVYMVDNKNTLIIYQNADDSFHRLSSH 227


>DQ666693-1|ABG29167.1|  250|Apis mellifera MAX dimerization protein
           protein.
          Length = 250

 Score = 24.6 bits (51), Expect = 0.87
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 582 LHGCHQLHGISS 617
           LHG H LHG+SS
Sbjct: 137 LHGLHGLHGLSS 148



 Score = 22.6 bits (46), Expect = 3.5
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = +3

Query: 582 LHGCHQLHGISSMYS 626
           LHG H LHG+  + S
Sbjct: 134 LHGLHGLHGLHGLSS 148


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 184 HNSNQKCNYDN 152
           HN+N K NY+N
Sbjct: 90  HNNNYKYNYNN 100


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 184 HNSNQKCNYDN 152
           HN+N K NY+N
Sbjct: 90  HNNNYKYNYNN 100


>DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 184 HNSNQKCNYDN 152
           HN+N K NY+N
Sbjct: 91  HNNNYKYNYNN 101


>DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 184 HNSNQKCNYDN 152
           HN+N K NY+N
Sbjct: 91  HNNNYKYNYNN 101


>DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 184 HNSNQKCNYDN 152
           HN+N K NY+N
Sbjct: 91  HNNNYKYNYNN 101


>DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 184 HNSNQKCNYDN 152
           HN+N K NY+N
Sbjct: 91  HNNNYKYNYNN 101


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 8/26 (30%), Positives = 11/26 (42%)
 Frame = +2

Query: 473 WINWMFSGFLTTKVPFPLTLRFKPML 550
           W +W F   +     FP    F P+L
Sbjct: 862 WRHWKFPNLVEVLDEFPSVRPFAPLL 887


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,161
Number of Sequences: 438
Number of extensions: 4174
Number of successful extensions: 12
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20343105
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -