Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt4n07
         (505 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U28734-3|AAR25654.1|  495|Caenorhabditis elegans K (potassium) v...    24   5.1  
U28734-2|AAB52604.3|  490|Caenorhabditis elegans K (potassium) v...    24   5.1  
U28734-4|AAR30209.1|  477|Caenorhabditis elegans K (potassium) v...    24   5.2  
Z36753-9|CAA85337.1|  445|Caenorhabditis elegans Hypothetical pr...    27   7.7  

>U28734-3|AAR25654.1|  495|Caenorhabditis elegans K (potassium)
           voltage-gated sensorychannel subunit protein 1, isoform
           b protein.
          Length = 495

 Score = 24.2 bits (50), Expect(2) = 5.1
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 192 WFINVHVLCNCCW 230
           W IN  ++ NCCW
Sbjct: 167 WKINDGLMSNCCW 179



 Score = 21.8 bits (44), Expect(2) = 5.1
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 294 DGNIIDCCWHG 326
           DG + +CCW G
Sbjct: 171 DGLMSNCCWRG 181


>U28734-2|AAB52604.3|  490|Caenorhabditis elegans K (potassium)
           voltage-gated sensorychannel subunit protein 1, isoform
           a protein.
          Length = 490

 Score = 24.2 bits (50), Expect(2) = 5.1
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 192 WFINVHVLCNCCW 230
           W IN  ++ NCCW
Sbjct: 162 WKINDGLMSNCCW 174



 Score = 21.8 bits (44), Expect(2) = 5.1
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 294 DGNIIDCCWHG 326
           DG + +CCW G
Sbjct: 166 DGLMSNCCWRG 176


>U28734-4|AAR30209.1|  477|Caenorhabditis elegans K (potassium)
           voltage-gated sensorychannel subunit protein 1, isoform
           c protein.
          Length = 477

 Score = 24.2 bits (50), Expect(2) = 5.2
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 192 WFINVHVLCNCCW 230
           W IN  ++ NCCW
Sbjct: 162 WKINDGLMSNCCW 174



 Score = 21.8 bits (44), Expect(2) = 5.2
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 294 DGNIIDCCWHG 326
           DG + +CCW G
Sbjct: 166 DGLMSNCCWRG 176


>Z36753-9|CAA85337.1|  445|Caenorhabditis elegans Hypothetical
           protein T09A5.11 protein.
          Length = 445

 Score = 27.1 bits (57), Expect = 7.7
 Identities = 19/65 (29%), Positives = 26/65 (40%)
 Frame = +1

Query: 127 GMQMYKPQLILSPMTIIFGGYLGSLMFMFFVTAVGNLETILXGKXFXLKLPEVVLSMGIS 306
           G  ++    IL+P   +FGG L       FV A GN+  +  G      L E+    G  
Sbjct: 66  GQLIFDHLFILAPGVQVFGGSLSPSEISKFVDAGGNV-LVAAGSNIGDALREIAAEHGFE 124

Query: 307 LIAAG 321
              AG
Sbjct: 125 FEEAG 129


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,492,989
Number of Sequences: 27780
Number of extensions: 164722
Number of successful extensions: 343
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 333
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 343
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 967231538
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)