SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt2o08
         (529 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    21   5.1  
AM292349-1|CAL23161.1|  248|Tribolium castaneum gustatory recept...    21   6.7  
AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical pro...    21   8.9  

>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 21.4 bits (43), Expect = 5.1
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 352 YLYIIVIDPLVIY 314
           YL  I+I+PLV+Y
Sbjct: 138 YLLPIIINPLVLY 150


>AM292349-1|CAL23161.1|  248|Tribolium castaneum gustatory receptor
           candidate 28 protein.
          Length = 248

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 10/32 (31%), Positives = 15/32 (46%)
 Frame = -1

Query: 322 VIYLIPFTQFLFLMLSFLRFQEIENIVGCTGD 227
           V  + P    LF+  +F+  Q  EN    +GD
Sbjct: 188 VYKVFPVEHLLFIANAFITSQSCENATLYSGD 219


>AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical
           protein protein.
          Length = 205

 Score = 20.6 bits (41), Expect = 8.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -1

Query: 451 VHSCRCNQFKN 419
           V +CRC  +KN
Sbjct: 174 VFTCRCKDYKN 184


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 106,220
Number of Sequences: 336
Number of extensions: 2096
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12782794
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -