Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt27n13
         (685 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor pr...    23   3.6  
Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    22   6.3  
DQ201783-1|ABB05503.1|  381|Apis mellifera capa receptor-like GP...    22   6.3  

>DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor
           protein.
          Length = 459

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -2

Query: 321 CNQPFHLQRLXY 286
           C  PFH+QRL Y
Sbjct: 272 CWAPFHVQRLLY 283


>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%)
 Frame = +3

Query: 450 NTKSLMSSLNVWKHIEDMRLQPV--KHMQVWDACSDALISFNSADN 581
           NT+SLM S N    ++  R+Q V    + V     + ++ F  A+N
Sbjct: 278 NTESLMKSENQGNDVQYERVQDVFDSQLTVKAVSKNGVLLFGLANN 323


>DQ201783-1|ABB05503.1|  381|Apis mellifera capa receptor-like GPCR
           protein.
          Length = 381

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -2

Query: 321 CNQPFHLQRLXY 286
           C  PFH QRL Y
Sbjct: 282 CWAPFHTQRLLY 293


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 155,655
Number of Sequences: 438
Number of extensions: 2915
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20830365
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)