BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmmt26e19
(705 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB067467-1|BAB67773.1| 642|Homo sapiens KIAA1880 protein protein. 30 7.0
>AB067467-1|BAB67773.1| 642|Homo sapiens KIAA1880 protein protein.
Length = 642
Score = 30.3 bits (65), Expect = 7.0
Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 7/67 (10%)
Frame = +2
Query: 5 INKIDNVHVTLIHIYPFIVNDEYHDV-----KLRIPSYFGTISP-VEAASSIL-DSVRRN 163
+ +ID+VH+ HI ++ +EY DV K R P++ ++ + ++L +R +
Sbjct: 43 VGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQYFRALLYGGMRES 102
Query: 164 YPEASVP 184
PEA +P
Sbjct: 103 QPEAEIP 109
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,732,070
Number of Sequences: 237096
Number of extensions: 1548935
Number of successful extensions: 2070
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2026
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2070
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8175213644
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -