SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt23o04
         (673 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              36   4e-04
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    22   4.6  
DQ435337-1|ABD92652.1|  135|Apis mellifera OBP20 protein.              21   8.1  
DQ435336-1|ABD92651.1|  135|Apis mellifera OBP19 protein.              21   8.1  

>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 35.9 bits (79), Expect = 4e-04
 Identities = 20/69 (28%), Positives = 39/69 (56%), Gaps = 4/69 (5%)
 Frame = +1

Query: 385 SEEEITRDLLAA--FKVFDRDDNGYITRDELQ--AALEMIGEPVTDAQLNQVLALGDIDH 552
           S++  +++ L +  F  +DR++NG + R+EL+  A  E + E      L  +++  D D 
Sbjct: 228 SQDNHSKEYLVSIMFSHYDRNNNGNLEREELEQFAENEDLEELCRGCNLGHMISYDDTDG 287

Query: 553 DGRIDYEEF 579
           DG+++  EF
Sbjct: 288 DGKLNVNEF 296


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 8/22 (36%), Positives = 13/22 (59%)
 Frame = +1

Query: 373 SGGDSEEEITRDLLAAFKVFDR 438
           +GG  E+ +  DLL  + V +R
Sbjct: 19  NGGSHEKRLLNDLLDTYNVLER 40


>DQ435337-1|ABD92652.1|  135|Apis mellifera OBP20 protein.
          Length = 135

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 6  EDSKPSRYND 35
          ED KP RYN+
Sbjct: 55 EDEKPQRYNE 64


>DQ435336-1|ABD92651.1|  135|Apis mellifera OBP19 protein.
          Length = 135

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 6  EDSKPSRYND 35
          ED KP RYN+
Sbjct: 55 EDEKPQRYNE 64


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,364
Number of Sequences: 438
Number of extensions: 3073
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20343105
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -