SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt23g20
         (361 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        21   5.9  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    20   7.7  

>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 20.6 bits (41), Expect = 5.9
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = -1

Query: 349 ETMASAYTGSEHPVNWRTRHNLPRSIASPP 260
           E+  SA   +   VN+  +HN P    S P
Sbjct: 40  ESSLSAAAVAAAAVNYAQQHNSPSPTGSSP 69


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +1

Query: 325 PCTRKPSSP 351
           PCT+ PS+P
Sbjct: 313 PCTQPPSAP 321


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.311    0.124    0.456 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 53,498
Number of Sequences: 438
Number of extensions: 922
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8432340
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.5 bits)

- SilkBase 1999-2023 -