SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt23f19
         (272 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0932 - 29488626-29488877,29488965-29489201,29489578-294899...    25   8.3  

>04_04_0932 -
           29488626-29488877,29488965-29489201,29489578-29489942,
           29490825-29491137
          Length = 388

 Score = 25.0 bits (52), Expect = 8.3
 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = -2

Query: 268 EVYYAQISNYE--ILCYYHDDLLAVEVAVVHQILFD 167
           E+ Y  I   E  +  ++HDD+  V V + H++L D
Sbjct: 324 EMKYNDIKKLEKGVRRFFHDDITVVVVFIDHELLQD 359


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,678,984
Number of Sequences: 37544
Number of extensions: 64417
Number of successful extensions: 157
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 156
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 157
length of database: 14,793,348
effective HSP length: 69
effective length of database: 12,202,812
effective search space used: 256259052
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -