SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt22n10
         (556 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               24   0.90 
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    22   4.8  
AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139 prot...    22   4.8  
AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.      22   4.8  
AB095513-1|BAC76335.1|   39|Apis mellifera brood-complex protein.      22   4.8  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          21   6.3  

>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 24.2 bits (50), Expect = 0.90
 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = +1

Query: 310 ENDTESIH-SSYRSDTLVNLNGPKSKVKKKQTL 405
           E++ ES   + Y  +   N+N P+ K+ KKQ +
Sbjct: 3   EDEVESFEITDYDLENEFNINRPRRKLSKKQQM 35


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = -1

Query: 481 NCNIYNT*IDNYIKYILYINNFI 413
           N N YN   +NY K + Y  N+I
Sbjct: 93  NYNNYNNNYNNYNKKLYYNINYI 115


>AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139
           protein.
          Length = 232

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = -1

Query: 445 IKYILYINNFIY 410
           IKY+L+I NF++
Sbjct: 8   IKYLLFIFNFVF 19


>AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.
          Length = 429

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +2

Query: 215 TQHYVMRWPKYK 250
           TQH+ +RW  Y+
Sbjct: 4   TQHFCLRWNNYQ 15


>AB095513-1|BAC76335.1|   39|Apis mellifera brood-complex protein.
          Length = 39

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = +2

Query: 215 TQHYVMRWPKYK 250
           TQH+ +RW  Y+
Sbjct: 4   TQHFCLRWNNYQ 15


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 218 QHYVMRWPKYK 250
           QHY +RW  Y+
Sbjct: 9   QHYCLRWNNYQ 19


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 127,188
Number of Sequences: 438
Number of extensions: 2187
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15949830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -