SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt21n12
         (456 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    26   0.22 
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    26   0.22 
AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    21   4.8  

>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 25.8 bits (54), Expect = 0.22
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -1

Query: 42   VHWARGHNGGVS 7
            +HW  GHNGG S
Sbjct: 1422 LHWKSGHNGGAS 1433


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 25.8 bits (54), Expect = 0.22
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -1

Query: 42   VHWARGHNGGVS 7
            +HW  GHNGG S
Sbjct: 1418 LHWKSGHNGGAS 1429


>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 21.4 bits (43), Expect = 4.8
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = -1

Query: 339 VIWLFFYILEMISNDNWFHSDWLDGTDDDRL 247
           V+ L  Y+L+  S    F     DGT++D L
Sbjct: 578 VVALVLYLLDRFSPFGRFKLANTDGTEEDAL 608


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,054
Number of Sequences: 438
Number of extensions: 1221
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12066642
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -