SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt20j16
         (609 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholi...    29   0.047
DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholi...    29   0.047
DQ058012-1|AAY57281.1|  373|Apis mellifera venom allergen acid p...    21   9.4  
AY939855-1|AAX33235.1|  388|Apis mellifera venom acid phosphatas...    21   9.4  

>DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 28.7 bits (61), Expect = 0.047
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%)
 Frame = +1

Query: 202 RYSCIWSVSSHISYCRFFGEHSFEKSFIKTSRSYRCLYI-HTSIIPSNICSIH 357
           R S +    S +S C  FG      SF++T    +  Y  HT II  ++C  H
Sbjct: 2   RASSVLQAESDVSSCVIFGVLFVLFSFLRTRTKLQPTYFHHTYIIYESLCGRH 54


>DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 28.7 bits (61), Expect = 0.047
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%)
 Frame = +1

Query: 202 RYSCIWSVSSHISYCRFFGEHSFEKSFIKTSRSYRCLYI-HTSIIPSNICSIH 357
           R S +    S +S C  FG      SF++T    +  Y  HT II  ++C  H
Sbjct: 2   RASSVLQAESDVSSCVIFGVLFVLFSFLRTRTKLQPTYFHHTYIIYESLCGRH 54


>DQ058012-1|AAY57281.1|  373|Apis mellifera venom allergen acid
           phosphatase protein.
          Length = 373

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +3

Query: 177 TNLASVLAPLQLY 215
           +N+ASVL  LQLY
Sbjct: 259 SNIASVLHALQLY 271


>AY939855-1|AAX33235.1|  388|Apis mellifera venom acid phosphatase
           precursor protein.
          Length = 388

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +3

Query: 177 TNLASVLAPLQLY 215
           +N+ASVL  LQLY
Sbjct: 274 SNIASVLHALQLY 286


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 151,357
Number of Sequences: 438
Number of extensions: 3188
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17971191
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -