BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmmt20f24
(670 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC126413-1|AAI26414.1| 711|Homo sapiens C10orf71 protein protein. 32 1.6
>BC126413-1|AAI26414.1| 711|Homo sapiens C10orf71 protein protein.
Length = 711
Score = 32.3 bits (70), Expect = 1.6
Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
Frame = +1
Query: 433 PAPREPECADY--GSMSKHSTATMQRNSHNDRVKSANLIAHLAPDRRRIKSTSSNSPILS 606
PA R P G K + R+S+ K+ +L+ +L R+R+KST S+SP+L
Sbjct: 464 PAERTPSPPGQLNGYQEKEPSECQSRDSYKS--KAPSLLFNLKDVRKRVKSTYSSSPLLK 521
Query: 607 TEENQQKPQND 639
+ + + + D
Sbjct: 522 VLDEKTRGKVD 532
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 80,712,753
Number of Sequences: 237096
Number of extensions: 1439672
Number of successful extensions: 2596
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2550
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2596
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7591280850
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -