SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt18h13
         (547 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    27   0.12 
L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        22   3.5  
AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    22   3.5  
AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    22   4.7  

>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 27.1 bits (57), Expect = 0.12
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 2/68 (2%)
 Frame = -3

Query: 236 HQLIQSSHLKVRNREFIVDTEVA*FGGIVQGIPSLLTGLV--ARGTDHPVFSHFHHKNLK 63
           H+ ++ S+ ++R   FI + E     G+     S   G V    G    V  HF+HK L+
Sbjct: 104 HEYLKFSYPRMRAPSFICENETR--QGLTLHYRSKRRGFVYYTMGQIREVARHFYHKELQ 161

Query: 62  INAVYNKL 39
           I  V  ++
Sbjct: 162 IELVREEI 169


>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 10/29 (34%), Positives = 13/29 (44%)
 Frame = -2

Query: 300 GLPSWSHLRRKCQACPDHLTAPPTDPKFP 214
           G+P   +L +  Q   DHL     D  FP
Sbjct: 109 GVPQLGNLTKHLQVFRDHLINQIPDKSFP 137


>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -2

Query: 375 GGHCYWP 355
           GG CYWP
Sbjct: 139 GGSCYWP 145


>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 21.8 bits (44), Expect = 4.7
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 107 CPWRQDLSADLGY 145
           CPW  +L+ D GY
Sbjct: 235 CPWICELTNDAGY 247


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 148,093
Number of Sequences: 438
Number of extensions: 3138
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15581757
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -