SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt15l21
         (627 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    23   2.4  
AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein...    23   3.2  
U26026-1|AAA69069.1|  377|Apis mellifera long-wavelength rhodops...    21   7.4  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    21   7.4  
DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    21   7.4  
DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex det...    21   7.4  
DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex det...    21   7.4  
DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex det...    21   7.4  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    21   7.4  
AB178034-1|BAD27112.1|   76|Apis mellifera apiceropsin protein.        21   7.4  
L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        21   9.8  
DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    21   9.8  

>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 8/26 (30%), Positives = 17/26 (65%)
 Frame = +2

Query: 107 VNHEGIPIKSSLDNATSVLYAGLIGQ 184
           + H+G PI+  +   T ++ AG++G+
Sbjct: 574 LTHKGKPIRMRIGIHTGMVLAGVVGK 599


>AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein
           protein.
          Length = 411

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 13/45 (28%), Positives = 19/45 (42%)
 Frame = -1

Query: 273 ISCLRLLTRRNVNSFVESISRTTFLAFSVSCPISPAYNTEVALSN 139
           I+C    T  N N+F+      T + F     I  + NT   LS+
Sbjct: 321 IACWDTNTELNPNTFILVAENNTTMVFCNDLSIDRSTNTMYVLSD 365


>U26026-1|AAA69069.1|  377|Apis mellifera long-wavelength rhodopsin
           protein.
          Length = 377

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +3

Query: 204 MWFVKWTPQM 233
           +WF+ WTP +
Sbjct: 286 LWFMAWTPYL 295


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 390 KTI*NNFNYKLTY 352
           KTI NN NYK  Y
Sbjct: 88  KTIHNNNNYKYNY 100


>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 390 KTI*NNFNYKLTY 352
           KTI NN NYK  Y
Sbjct: 88  KTIHNNNNYKYNY 100


>DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 390 KTI*NNFNYKLTY 352
           KTI NN NYK  Y
Sbjct: 88  KTIHNNNNYKYNY 100


>DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 390 KTI*NNFNYKLTY 352
           KTI NN NYK  Y
Sbjct: 88  KTIHNNNNYKYNY 100


>DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 390 KTI*NNFNYKLTY 352
           KTI NN NYK  Y
Sbjct: 88  KTIHNNNNYKYNY 100


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = -1

Query: 390 KTI*NNFNYKLTY 352
           KTI NN NYK  Y
Sbjct: 321 KTIHNNNNYKYNY 333


>AB178034-1|BAD27112.1|   76|Apis mellifera apiceropsin protein.
          Length = 76

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +3

Query: 204 MWFVKWTPQM 233
           +WF+ WTP +
Sbjct: 36  LWFMAWTPYL 45


>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 9/30 (30%), Positives = 17/30 (56%)
 Frame = +2

Query: 146 NATSVLYAGLIGQLTEKARNVVREMDSTNE 235
           N TS    GL+G   ++A  + R+M ++ +
Sbjct: 263 NLTSGERVGLVGGRVKEALRIARQMTTSRK 292


>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 229 CGVHFTNHIPGLL 191
           CGVH  + +PG+L
Sbjct: 329 CGVHNLHGMPGIL 341


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,415
Number of Sequences: 438
Number of extensions: 4288
Number of successful extensions: 12
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18704709
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -