SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt15l17
         (365 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    23   1.1  
DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    21   3.4  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    21   3.4  
AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.     21   6.0  

>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 23.0 bits (47), Expect = 1.1
 Identities = 16/60 (26%), Positives = 25/60 (41%), Gaps = 7/60 (11%)
 Frame = -2

Query: 295 ILFCIIN*SIVTLFFSSKLQNSALSCFKNVFSN-------RMVLNRFHHEIDFLVRSKTY 137
           I   I+N  I  +  S +L N  L     VFSN          LN  +  ++++ +  TY
Sbjct: 10  ISLIILNDEIYNIIASPQLNNPTLFMIGGVFSNNKSKKYFEQTLNELNFNLNYVNKGVTY 69


>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 3.4
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 69  NIVEWSTYLF 98
           N+  WSTYLF
Sbjct: 431 NLAYWSTYLF 440


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 3.4
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 69  NIVEWSTYLF 98
           N+  WSTYLF
Sbjct: 431 NLAYWSTYLF 440


>AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.
          Length = 602

 Score = 20.6 bits (41), Expect = 6.0
 Identities = 12/39 (30%), Positives = 18/39 (46%)
 Frame = +3

Query: 216 KQLNAEFCNLEEKKSVTID*FMIQNKMLSLFLNCIS*YK 332
           K +NAE  N+EE  ++T     I N  +       + YK
Sbjct: 558 KGINAEPSNIEESNNMTDSFTRIANNTIQELYTLNNMYK 596


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 92,988
Number of Sequences: 438
Number of extensions: 1732
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8680350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -