SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt10n02
         (654 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0406 + 3143701-3143801,3143910-3144063,3145032-3145164,314...    29   4.3  

>03_01_0406 +
           3143701-3143801,3143910-3144063,3145032-3145164,
           3145336-3145358
          Length = 136

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 16/40 (40%), Positives = 26/40 (65%)
 Frame = +2

Query: 401 NSCTWIVEYPRHLYKAGQYVTKISLEKNFLGIWWPVSTSK 520
           +SC  ++ +P  +++AG+Y T  S  K+F GIW  V+T K
Sbjct: 17  HSCQLMMFHPIEIWEAGRYET--SDAKSFSGIW--VATGK 52


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,828,096
Number of Sequences: 37544
Number of extensions: 270063
Number of successful extensions: 523
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 514
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 523
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1632177336
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -