BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10l05 (632 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 22 4.9 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.6 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -3 Query: 378 SGLSAARAPPHCRSASALWATAAREQH 298 +GLS C A+ALW E H Sbjct: 46 TGLSLPACRLFCSEAAALWPKPTGEVH 72 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = -2 Query: 190 IVISVKYNRLPNKRLLIILSLFAHFSSYLRYMCSLCTVTTH 68 I + V+ ++ LL I + +++ + Y+C +C T H Sbjct: 618 ICVIVQSEQIAWLHLLYIFLVGIMYAADVFYICHVCCSTIH 658 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,940 Number of Sequences: 336 Number of extensions: 2613 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -