BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10l05 (632 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 29 0.093 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 23 6.1 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 8.1 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 29.5 bits (63), Expect = 0.093 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +3 Query: 237 REKALSHSLFYLKLGAGMTPDVAREPQSPTARRPSGSAVARAPPTTRFQ-RHAQPRVS 407 R++ + +SL K+G G R+P +P RR S + R Q QPR S Sbjct: 179 RDRDVLNSLLAAKVGGGQPSASPRQPPTPLPRRSSAQPQQQQQQQQRNQHEQEQPRAS 236 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 23.4 bits (48), Expect = 6.1 Identities = 14/61 (22%), Positives = 25/61 (40%), Gaps = 3/61 (4%) Frame = -2 Query: 256 WLNAFSRNTRRKSSVGGFSRRGIVISVKYNRLPNKRLL---IILSLFAHFSSYLRYMCSL 86 W+ + ++ V + +GI + V Y P K +L + L L F Y ++ Sbjct: 220 WVELNATQAMQRWVVERVANKGIFVEVYYAESPRKEILPHEVGLILSNRFGRYQPFLVGY 279 Query: 85 C 83 C Sbjct: 280 C 280 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.0 bits (47), Expect = 8.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 370 QPASNDTRNHVSPSSCVASNP 432 QP ++D NH + S+ NP Sbjct: 438 QPPTSDAPNHTTTSTTTEGNP 458 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,821 Number of Sequences: 2352 Number of extensions: 12004 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -