BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10l05 (632 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 27 0.15 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 1.4 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 9.9 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 9.9 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 27.1 bits (57), Expect = 0.15 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 135 CHYLHISALISDICVPCVQLP 73 C+YL +S +SD+CV + +P Sbjct: 76 CNYLLVSLAVSDLCVALLVMP 96 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.8 bits (49), Expect = 1.4 Identities = 14/54 (25%), Positives = 22/54 (40%) Frame = -3 Query: 339 SASALWATAAREQHPASCRRPASNKTSYGLMPFHVTLDGSPPLGGFPGAASLSP 178 S ++ A + + PA + P S +P + G PPL PG+ P Sbjct: 390 SPVSMSALVSAVRSPAGGQLPPSAGAPMPPIPNMSNMSGMPPLPNMPGSMPTMP 443 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 121 VQIVTKLSRAFYLEADYILRR 183 ++I L FY DYI+R+ Sbjct: 230 IKISDVLEETFYNNGDYIIRQ 250 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.0 bits (42), Expect = 9.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 343 PLGLRAVGDCGSRATSGVMPAPSFK 269 PLG AV D GV+ A +FK Sbjct: 420 PLGRFAVRDMRQTVAVGVIKAVTFK 444 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,036 Number of Sequences: 438 Number of extensions: 3109 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -