BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10k24 (403 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81076-2|CAB03051.3| 333|Caenorhabditis elegans Hypothetical pr... 29 1.7 U41551-5|AAK77627.2| 1050|Caenorhabditis elegans Clc-type chlor... 26 8.8 U41551-4|AAK77628.1| 1085|Caenorhabditis elegans Clc-type chlor... 26 8.8 AF319615-1|AAG49525.1| 1084|Caenorhabditis elegans CLC-type chlo... 26 8.8 AF173173-1|AAF13166.1| 978|Caenorhabditis elegans CLC chloride ... 26 8.8 >Z81076-2|CAB03051.3| 333|Caenorhabditis elegans Hypothetical protein F35C5.2 protein. Length = 333 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 63 THWIVWKNLVICLFAIIAMVSGVTFAIKSMLENL*FS 173 T WI+ N++ C F I GV + I+ M ++ FS Sbjct: 19 TSWILRLNIIYCTFLSIGCFVGVAYCIRFMRKHPIFS 55 >U41551-5|AAK77627.2| 1050|Caenorhabditis elegans Clc-type chloride channel protein4, isoform a protein. Length = 1050 Score = 26.2 bits (55), Expect = 8.8 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = +3 Query: 66 HWIVWKNLVICLFAIIAMVSGV 131 HWIV+ ++ C+F++++ G+ Sbjct: 421 HWIVYPIVISCIFSVVSYPHGL 442 >U41551-4|AAK77628.1| 1085|Caenorhabditis elegans Clc-type chloride channel protein4, isoform b protein. Length = 1085 Score = 26.2 bits (55), Expect = 8.8 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = +3 Query: 66 HWIVWKNLVICLFAIIAMVSGV 131 HWIV+ ++ C+F++++ G+ Sbjct: 421 HWIVYPIVISCIFSVVSYPHGL 442 >AF319615-1|AAG49525.1| 1084|Caenorhabditis elegans CLC-type chloride channel CLH-4b protein. Length = 1084 Score = 26.2 bits (55), Expect = 8.8 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = +3 Query: 66 HWIVWKNLVICLFAIIAMVSGV 131 HWIV+ ++ C+F++++ G+ Sbjct: 421 HWIVYPIVISCIFSVVSYPHGL 442 >AF173173-1|AAF13166.1| 978|Caenorhabditis elegans CLC chloride channel protein protein. Length = 978 Score = 26.2 bits (55), Expect = 8.8 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = +3 Query: 66 HWIVWKNLVICLFAIIAMVSGV 131 HWIV+ ++ C+F++++ G+ Sbjct: 349 HWIVYPIVISCIFSVVSYPHGL 370 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,507,158 Number of Sequences: 27780 Number of extensions: 129295 Number of successful extensions: 309 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 309 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 630384202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -