BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10k19 (401 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.06c |||nicotinamide mononucleotide |Schizosaccharomyces ... 27 1.1 SPBC16D10.02 |trm11||tRNA |Schizosaccharomyces pombe|chr 2|||Manual 27 1.4 SPAC14C4.04 |B22918-2||hypothetical protein|Schizosaccharomyces ... 27 1.4 SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces po... 26 1.9 SPBP23A10.10 |ppk32||serine/threonine protein kinase Ppk32 |Schi... 25 3.3 SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe... 25 5.8 SPCC61.05 |||S. pombe specific multicopy membrane protein family... 25 5.8 SPAC25H1.03 |mug66|mug66|meiotically upregulated gene Mug66|Schi... 24 7.7 >SPAC806.06c |||nicotinamide mononucleotide |Schizosaccharomyces pombe|chr 1|||Manual Length = 365 Score = 27.1 bits (57), Expect = 1.1 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 258 FYSPIRDYSKEESPAPKY*TVFLILISC 341 ++SP+ D+ K+E AP Y V + ++C Sbjct: 163 YFSPVNDHYKKEGLAPAYHRVRMCELAC 190 >SPBC16D10.02 |trm11||tRNA |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 26.6 bits (56), Expect = 1.4 Identities = 9/19 (47%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = +3 Query: 207 KKTNPEPWEAYR-NKQYKF 260 K+ NP PW++++ N YKF Sbjct: 119 KELNPAPWDSFKHNSSYKF 137 >SPAC14C4.04 |B22918-2||hypothetical protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 267 Score = 26.6 bits (56), Expect = 1.4 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 117 PLYVCVGIGCGGAVFYTLRLALRNPDVSWNKKTNPEPWEAY 239 PL+V +G G TL++ + PD ++ +PW+ + Sbjct: 22 PLWVPTPVGRSGRKHRTLKMCIVLPDTGYDVTQVCDPWQFF 62 >SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces pombe|chr 1|||Manual Length = 949 Score = 26.2 bits (55), Expect = 1.9 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -3 Query: 201 KIHQDYAKPDAEYRTQLHHILSPHIHTEGSKPYASSNLRGSVL 73 +I Q+YA+ + R L L H EGS S++ GS+L Sbjct: 81 EISQEYARYSKQKRASLRRYLEKHGKLEGS--MKESSINGSLL 121 >SPBP23A10.10 |ppk32||serine/threonine protein kinase Ppk32 |Schizosaccharomyces pombe|chr 2|||Manual Length = 749 Score = 25.4 bits (53), Expect = 3.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 178 LCVILMYLGTRRPTLNHGRLTGTSSTSSILPSET 279 L +L + TR PT+ G +T S +I+P ET Sbjct: 522 LLPVLEKVKTREPTVVMGMVTVYISAGAIIPEET 555 >SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1465 Score = 24.6 bits (51), Expect = 5.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 141 LSPHIHTEGSKPYASSNLRGS 79 L+P IH EG + Y+SS + S Sbjct: 829 LAPSIHVEGLETYSSSERKDS 849 >SPCC61.05 |||S. pombe specific multicopy membrane protein family 1|Schizosaccharomyces pombe|chr 3|||Manual Length = 469 Score = 24.6 bits (51), Expect = 5.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 266 RIELVLLVPVSLPWFRVG 213 RI VLL+ + LPWF G Sbjct: 2 RINFVLLITLILPWFVSG 19 >SPAC25H1.03 |mug66|mug66|meiotically upregulated gene Mug66|Schizosaccharomyces pombe|chr 1|||Manual Length = 184 Score = 24.2 bits (50), Expect = 7.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 168 LRLALRNPDVSWNKKTNPEPWEAY 239 L L R+P SW K N PWE + Sbjct: 83 LLLYERSPKKSWFGKGNTIPWEQW 106 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,705,831 Number of Sequences: 5004 Number of extensions: 35403 Number of successful extensions: 101 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 136158338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -