BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10k17 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 29 0.17 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 24 3.6 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 28.7 bits (61), Expect = 0.17 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 426 EGEKFVNDSLGRINTATDAAEASKSAD 506 EGE+ VN LG NTATD A + D Sbjct: 167 EGERLVNVRLGEYNTATDTDCADGNPD 193 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.2 bits (50), Expect = 3.6 Identities = 16/75 (21%), Positives = 33/75 (44%) Frame = +3 Query: 345 DALAKAKKSIGTNLSRVAKKMYKDNPQEGEKFVNDSLGRINTATDAAEASKSADLVVEAI 524 +A+ K+ + L + Q +ND + R+N A S+ + V + Sbjct: 768 EAMTSTKEGLENELHQELMSQLSVQDQHEVDSLNDEIRRLNQENKEAFTSRMSLEVTKNK 827 Query: 525 VENIEVKHKLFKQLD 569 +EN+ + + LF++ D Sbjct: 828 LENL-LTNNLFRRKD 841 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,057 Number of Sequences: 2352 Number of extensions: 11783 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -