BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10k08 (717 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 29 0.19 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 2.3 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 4.1 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 24 5.4 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 24 5.4 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 24 5.4 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 24 5.4 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 24 5.4 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 24 5.4 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 24 5.4 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 24 5.4 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 24 5.4 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 24 5.4 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 24 5.4 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 24 5.4 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 24 5.4 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 24 5.4 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 24 5.4 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 24 5.4 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 24 5.4 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 24 5.4 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 24 5.4 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 24 5.4 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 24 5.4 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 24 5.4 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 24 5.4 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 24 5.4 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 24 5.4 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 24 5.4 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 24 5.4 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 5.4 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 5.4 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 5.4 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 5.4 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 5.4 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 5.4 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 5.4 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 5.4 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 5.4 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 24 5.4 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 7.2 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 23 9.5 AJ439060-15|CAD27766.1| 56|Anopheles gambiae putative ribosoma... 23 9.5 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 9.5 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 28.7 bits (61), Expect = 0.19 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 3/79 (3%) Frame = +2 Query: 428 LAAYYGGWQAVCACRVLQGLSQGFTYPSIHNLIGKWVPLE-EKSRLGT--IIYAGGQLGT 598 L Y G A A V+ S GF Y SI + G W P + + S+ GT ++ G G Sbjct: 2748 LTGYIG---ATAAIGVITATSVGFAYVSIASANGSWDPSKWDWSQPGTWNALFIGSLTGA 2804 Query: 599 ALQLMASGFIAQYWGWPAI 655 +L G + G+ I Sbjct: 2805 SLFNAVGGVHKAFIGYTGI 2823 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 619 WFHSPVLGLAGNILRQRCFRCHLDS 693 W H GL I+ + +CHLDS Sbjct: 279 WLHMAGDGLLAGIVEENDKQCHLDS 303 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 149 RREPSAVKIAQPVHKVIAQPVDVSSYAHAPV-AHATVQHH 187 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 50 DQDISLYHRLSITTKYYETNIVPKSR 75 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 50 DQDISLYHRLSITTKYYETNIVPKSR 75 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 52 DQDISLYHRLSITTKYYETNIVPKSR 77 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 52 DQDISLYHRLSITTKYYETNIVPKSR 77 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 55 DQDISLYHRLSITTKYYETNIVPKSR 80 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 55 DQDISLYHRLSITTKYYETNIVPKSR 80 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 65 DQDISLYHRLSITTKYYETNIVPKSR 90 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 67 DQDISLYHRLSITTKYYETNIVPKSR 92 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 67 DQDISLYHRLSITTKYYETNIVPKSR 92 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 49 DQDISLYHRLSITTKYYETNIVPKSR 74 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 49 DQDISLYHRLSITTKYYETNIVPKSR 74 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 382 DQDFSSEFSCQFSTRYLQHHVAPKER 305 DQD S +T+Y + ++ PK R Sbjct: 64 DQDISLYHRLSITTKYYETNIVPKSR 89 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 149 RREPSAVKIAQPVHKVIAQPVHVSSYAHAPV-AHATVQHH 187 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 141 RREPSAVKIAQPVHKVIAQNVHVSSYAHAPV-AHATVQHH 179 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 141 RREPSAVKIAQPVHKVIAQPVHVSSYAHAPV-AHATVQHH 179 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 149 RREPSAVKIAQPVHKVIAQPVHVSSYAHAPV-AHATVQHH 187 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 141 RREPSAVKIAQPVHKVIAQPVHVSSYAHAPV-AHATVQHH 179 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 149 RREPSAVKIAQPVHKVIAQPVHVSSYAHAPV-AHATVQHH 187 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 173 RREPSAVKIAQPVHKVIAQPVHVSSYAHAPV-AHATVQHH 211 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 141 RREPSAVKIAQPVHKVIAQPVHVSSYAHAPV-AHATVQHH 179 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 141 RREPSAVKIAQPVHKVIAQPVHVSSYAHAPV-AHATVQHH 179 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 141 RPEPSAVKIAQPVHKVIAQPVHVSSYAHAPV-AHATVQHH 179 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 307 RGEDHALGLHAPIEGILVVLVGHSNDGHANVDSHSICQHH 188 R E A+ + P+ ++ V S+ HA V +H+ QHH Sbjct: 149 RREPSAVKIAHPVHKVIAQPVHVSSYAHAPV-AHATVQHH 187 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 312 FGATWCCRYLVENWQLNSEEKSWS 383 +G T + N++LN+ E+ WS Sbjct: 52 YGVTKGTVVFINNYELNTSERYWS 75 >AJ439060-15|CAD27766.1| 56|Anopheles gambiae putative ribosomal protein protein. Length = 56 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 317 PKRTRRGSRFGFACSN 270 P++ +GSRF ACSN Sbjct: 11 PRKYGQGSRFWRACSN 26 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 688 PDGT*STVDVKYCRPAPVLGYETRC 614 P G ++ +V C+P GY T+C Sbjct: 327 PWGRATSKNVHECKPCNCNGYSTKC 351 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 873,596 Number of Sequences: 2352 Number of extensions: 19228 Number of successful extensions: 103 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -