BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10k07 (716 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g34581.1 68418.m04037 hydroxyproline-rich glycoprotein family... 30 1.3 At2g36250.2 68415.m04450 chloroplast division protein FtsZ (FtsZ... 30 1.8 At2g36250.1 68415.m04449 chloroplast division protein FtsZ (FtsZ... 30 1.8 At4g12970.1 68417.m02026 expressed protein 29 4.1 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 28 5.4 At1g08600.1 68414.m00953 SNF2 domain-containing protein / helica... 27 9.4 >At5g34581.1 68418.m04037 hydroxyproline-rich glycoprotein family protein Length = 161 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = -2 Query: 328 MMCLLTSWTTPPLFPKEDPTRTLQTPTRSPIIQCAAVRTALLLRMEQPHP--CHH 170 + C+ ++ P P + P +T+QTPT + + + L+R +Q P C H Sbjct: 23 LCCITDCFSEPATRPHKSPPQTIQTPTPARSHSQSGSQQPPLIRRKQQQPLACQH 77 >At2g36250.2 68415.m04450 chloroplast division protein FtsZ (FtsZ2-1) identical to chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] GI:15636809, plastid division protein FtsZ [Arabidopsis thaliana] GI:14195704 Length = 478 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +3 Query: 432 AGSNYNLADNQVVWAAGWGSTRTGSGFAEQLRHVQVWTINQAICRERYSRI 584 A SNYN A +V+ G GS ++ V+ W +N I R S + Sbjct: 112 APSNYNEARIKVIGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPV 162 >At2g36250.1 68415.m04449 chloroplast division protein FtsZ (FtsZ2-1) identical to chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] GI:15636809, plastid division protein FtsZ [Arabidopsis thaliana] GI:14195704 Length = 478 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +3 Query: 432 AGSNYNLADNQVVWAAGWGSTRTGSGFAEQLRHVQVWTINQAICRERYSRI 584 A SNYN A +V+ G GS ++ V+ W +N I R S + Sbjct: 112 APSNYNEARIKVIGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPV 162 >At4g12970.1 68417.m02026 expressed protein Length = 102 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/61 (22%), Positives = 22/61 (36%) Frame = -1 Query: 317 VDLMDNTSTISKRRSYANSPNTDTISYNTMCGCKDGSVIENGTATSLPPLGHIARKKCCC 138 V L+ ++ RR + T +YN GC+ E P+ +C C Sbjct: 41 VSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVC 100 Query: 137 H 135 H Sbjct: 101 H 101 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 456 RQGCNWNPQYELAARYYVRSLSVKLYA*LQYQRPLYD 346 + G N PQY L + Y ++K A +Q+ LYD Sbjct: 962 QDGANQKPQYSLRSLYRALEYAIKAEAIGGFQKALYD 998 >At1g08600.1 68414.m00953 SNF2 domain-containing protein / helicase domain-containing protein similar to SP|P46100 Transcriptional regulator ATRX {Homo sapiens}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; non-consensus GC donor splice site at exon boundary 28614 Length = 1457 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -1 Query: 332 VDDVPVDLMDNTSTISKRRSYANSPNTDTISYNTMCGCKDGSVIENGTATSLPPLGHI 159 +DD V L N +T + + SP T T +N+ ++ N + P HI Sbjct: 377 MDDDSVYLDGNNTTPNFAKDQVKSPETSTQVHNSEVNIEENGNFSNSDVDKMTPSTHI 434 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,141,460 Number of Sequences: 28952 Number of extensions: 336280 Number of successful extensions: 904 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -