SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt10k05
         (745 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5KB17 Cluster: Putative uncharacterized protein; n=1; ...    33   9.8  

>UniRef50_A5KB17 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium vivax|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 140

 Score = 32.7 bits (71), Expect = 9.8
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%)
 Frame = -2

Query: 612 HLLLSF--GFSCPFSLGSFCHLFQASFFPWPLIFLTSCLPSPIFFP 481
           HL ++F   F CPF    FC  F   F+P+ L    +  P P  +P
Sbjct: 60  HLCVNFPCAFFCPFFYPFFCPFFYPFFYPFFLSIFLAHFPCPFSWP 105


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 303,409,308
Number of Sequences: 1657284
Number of extensions: 3895009
Number of successful extensions: 12136
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11170
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12021
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 60911752460
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -