BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10j14 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58788| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-19 SB_8491| Best HMM Match : LicD (HMM E-Value=0.0094) 30 1.4 SB_24662| Best HMM Match : DUF229 (HMM E-Value=1.2e-26) 29 3.3 >SB_58788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 68.5 bits (160), Expect(2) = 3e-19 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 4/90 (4%) Frame = +1 Query: 187 IAATSVLQIRASEIRQTRINWQSYLQSQMITQRDHDFIVNLD----QRGQKDLPDKNPDA 354 + A S L A E+R+ +NWQSY+ +MI+Q D+ I + D K + D+ D Sbjct: 31 VIAGSRLVADAVEVRKQTVNWQSYVHGKMISQEDYSMIADYDCMDPVERAKIISDRG-DQ 89 Query: 355 CAEVFLNLLTHISKDHTIQYILVLIDDILS 444 A+ L+LL +++DHTI+YILVLIDD+L+ Sbjct: 90 LAKTCLSLLVKLTRDHTIRYILVLIDDMLN 119 Score = 44.4 bits (100), Expect(2) = 3e-19 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = +1 Query: 562 IIAKLACWHPQLMDKSDLHFYLSWLKDQL 648 I+AKLACW + +SDL+F+LSWLK+QL Sbjct: 123 IVAKLACWGNVRLPESDLNFFLSWLKNQL 151 >SB_8491| Best HMM Match : LicD (HMM E-Value=0.0094) Length = 289 Score = 30.3 bits (65), Expect = 1.4 Identities = 24/106 (22%), Positives = 41/106 (38%), Gaps = 1/106 (0%) Frame = +1 Query: 310 DQRGQKDLPDKNPDACAEVFLNLLTHISKDHTIQYILVLIDDILSEDKSRVKIFRETKFS 489 D R Q + + L I+K H I Y L D I + + ++ + Sbjct: 101 DIRNQSQYSHRQGQLITTRMMRLFDLIAKKHNISYWLTSADYIKFFEVAAKELPSDMFLQ 160 Query: 490 GNVWQPFLNLLNRQ-DEFVQHMTARIIAKLACWHPQLMDKSDLHFY 624 ++ P+L N+Q + H I + W+P+L DK + Y Sbjct: 161 NSISDPYLRPDNKQYAASITHPKVGIYQR--SWNPRLRDKKSCYKY 204 >SB_24662| Best HMM Match : DUF229 (HMM E-Value=1.2e-26) Length = 972 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/40 (27%), Positives = 24/40 (60%), Gaps = 5/40 (12%) Frame = -2 Query: 112 PNILSIK-----CSKTEKSFNICVFLEKQTIRHCSGERSC 8 P+I+++K C K ++ +CV+ ++ + C+ +RSC Sbjct: 743 PHIVNVKSKDKSCWKKSDNWQVCVYRRRRPFKVCNSQRSC 782 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,298,415 Number of Sequences: 59808 Number of extensions: 371553 Number of successful extensions: 883 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -