BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10j14 (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g42050.1 68416.m04311 vacuolar ATP synthase subunit H family ... 66 3e-11 At4g31490.1 68417.m04473 coatomer beta subunit, putative / beta-... 37 0.010 At4g31480.1 68417.m04472 coatomer beta subunit, putative / beta-... 37 0.010 At1g31730.1 68414.m03893 epsilon-adaptin, putative similar to SP... 33 0.22 At5g02100.1 68418.m00131 oxysterol-binding family protein simila... 28 4.7 At1g66730.1 68414.m07585 ATP dependent DNA ligase family protein... 28 4.7 At4g31570.1 68417.m04483 expressed protein 27 8.2 >At3g42050.1 68416.m04311 vacuolar ATP synthase subunit H family protein identical to probable vacuolar ATP synthase subunit H (EC 3.6.3.14)(V-ATPase H subunit) (Vacuolar proton pump H subunit) (Vacuolar proton pump subunit SFD) SP:Q9LX65 from [Arabidopsis thaliana]; contains Pfam PF03224: V-ATPase subunit H Length = 441 Score = 65.7 bits (153), Expect = 3e-11 Identities = 30/133 (22%), Positives = 77/133 (57%), Gaps = 4/133 (3%) Frame = +1 Query: 208 QIRASEIRQTRINWQSYLQSQMITQRDHDFIVNLDQRGQK---DLPDKNPDACAEVFLNL 378 ++ ++ + I W++Y+ +++++ + + D++ + L D++ A +F+++ Sbjct: 5 ELSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKPESARAQLLDEDGPAYVHLFVSI 64 Query: 379 LTHISKDHTIQYILVLIDDILSEDKSRVKIFRETKFSG-NVWQPFLNLLNRQDEFVQHMT 555 L I K+ T++Y+L LI ++LS + +R ++F + + + ++PFL LL + + F+Q + Sbjct: 65 LRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLANEDTYEPFLRLLWKGNWFIQEKS 124 Query: 556 ARIIAKLACWHPQ 594 +I+A + P+ Sbjct: 125 CKILAWIISARPK 137 >At4g31490.1 68417.m04473 coatomer beta subunit, putative / beta-coat protein, putative / beta-COP, putative similar to Coatomer beta subunit (Beta-coat protein) (Beta-COP) from {Rattus norvegicus} SP|P23514, {Mus musculus} SP|Q9JIF7, {Homo sapiens} SP|P53618; contains Pfam profile: PF01602 Adaptin N terminal region Length = 948 Score = 37.1 bits (82), Expect = 0.010 Identities = 19/80 (23%), Positives = 45/80 (56%), Gaps = 2/80 (2%) Frame = +1 Query: 343 NPDACAEVFLNLLTHI--SKDHTIQYILVLIDDILSEDKSRVKIFRETKFSGNVWQPFLN 516 N + ++F+ ++ ++ S+DHTIQ +L+L +++ + S+ K+ E + Q N Sbjct: 47 NGETIPQLFITIIRYVLPSEDHTIQKLLLLYLELIEKTDSKGKVLPEMIL---ICQNLRN 103 Query: 517 LLNRQDEFVQHMTARIIAKL 576 L +E+++ +T R + ++ Sbjct: 104 NLQHPNEYIRGVTLRFLCRM 123 >At4g31480.1 68417.m04472 coatomer beta subunit, putative / beta-coat protein, putative / beta-COP, putative similar to Coatomer beta subunit (Beta-coat protein) (Beta-COP) from {Rattus norvegicus} SP|P23514, {Mus musculus} SP|Q9JIF7, {Homo sapiens} SP|P53618; contains Pfam profile: PF01602 Adaptin N terminal region Length = 971 Score = 37.1 bits (82), Expect = 0.010 Identities = 19/80 (23%), Positives = 45/80 (56%), Gaps = 2/80 (2%) Frame = +1 Query: 343 NPDACAEVFLNLLTHI--SKDHTIQYILVLIDDILSEDKSRVKIFRETKFSGNVWQPFLN 516 N + ++F+ ++ ++ S+DHTIQ +L+L +++ + S+ K+ E + Q N Sbjct: 70 NGETIPQLFITIIRYVLPSEDHTIQKLLLLYLELIEKTDSKGKVLPEMIL---ICQNLRN 126 Query: 517 LLNRQDEFVQHMTARIIAKL 576 L +E+++ +T R + ++ Sbjct: 127 NLQHPNEYIRGVTLRFLCRM 146 >At1g31730.1 68414.m03893 epsilon-adaptin, putative similar to SP|Q9UPM8 Adapter-related protein complex 4 epsilon 1 subunit (Epsilon subunit of AP-4) (AP-4 adapter complex epsilon subunit) {Homo sapiens}; contains Pfam profile: PF01602 Adaptin N terminal region Length = 938 Score = 32.7 bits (71), Expect = 0.22 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +1 Query: 256 YLQSQMITQRDHDFIVNLDQRGQKDL-PDKNPDACAEVFLNLLTHISKDHTIQYILVLID 432 YL + DHD I+ + QKDL D CA LN + + + TI +L + Sbjct: 106 YLAVTLFLNEDHDLIILIVNTIQKDLRSDNYLVVCAA--LNAICRLINEETIPAVLPQVV 163 Query: 433 DILSEDKSRVK 465 ++L+ K V+ Sbjct: 164 ELLNHQKEAVR 174 >At5g02100.1 68418.m00131 oxysterol-binding family protein similar to SWH1 [Saccharomyces cerevisiae] GI:402658; contains Pfam profile PF01237: Oxysterol-binding protein Length = 453 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 499 WQPFLNLLNRQDEFVQHMTARIIAKLACWHPQL 597 W+PF +L E H IA+ C HP + Sbjct: 142 WKPFNPILGETYEMTNHNGINFIAEQVCHHPPM 174 >At1g66730.1 68414.m07585 ATP dependent DNA ligase family protein contains Pfam profile: PF01068 ATP dependent DNA ligase domain Length = 1417 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = -2 Query: 628 RDRSANHFCPSAADASKLAWQ*CEQSCAGQIHPDGSANSGRAAKRCQRISSHE 470 R+ +H + + + C ++C+ Q S NSG A C + S+ E Sbjct: 685 REIPGDHAGERGLSSKTIQYPKCSEACSSQEDKKASENSGHAVNICVQTSAEE 737 >At4g31570.1 68417.m04483 expressed protein Length = 2712 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +1 Query: 475 ETKFSGNVWQPFLNLLNRQDEFV---QHMTARIIAKLACWHPQL 597 ET GN+ + +L D+FV H+ ++ LA WH Q+ Sbjct: 2135 ETSSGGNIAEICGSLSQNLDQFVVGVSHLEEKVSKHLATWHDQI 2178 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,364,550 Number of Sequences: 28952 Number of extensions: 253539 Number of successful extensions: 699 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -