BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10j08 (446 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 25 1.6 DQ022108-1|AAY51996.1| 66|Anopheles gambiae voltage-gated sodi... 24 2.1 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 3.7 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 23 4.9 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 23 4.9 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 23 4.9 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 23 4.9 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 4.9 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 6.5 AY752899-1|AAV30073.1| 43|Anopheles gambiae peroxidase 5B prot... 22 8.6 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 24.6 bits (51), Expect = 1.6 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +2 Query: 197 KKEAKLREIEAKEKVIRDAKLKEEKERA 280 K A ++E + EK ++DA+ EE+++A Sbjct: 338 KVAASVKETQEGEKKVKDAQEAEERKKA 365 >DQ022108-1|AAY51996.1| 66|Anopheles gambiae voltage-gated sodium channel protein. Length = 66 Score = 24.2 bits (50), Expect = 2.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 382 FFHISIKIANSVVINLF 432 FF ++ I NSVV+NLF Sbjct: 42 FFLATVVIGNSVVLNLF 58 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.4 bits (48), Expect = 3.7 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 191 LSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 310 L+ KE K +E+ AK+ KEE+++ E+K+L + Sbjct: 365 LNLKEQKRKELYAKQGRGSQFSSKEERDKWIQGELKSLNK 404 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 4.9 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +3 Query: 45 IIVLQYSNFITKCQIYHTEHLC 110 I+VL N++ K +++ +H+C Sbjct: 136 IMVLNDHNYVYKDSVFNPQHVC 157 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 4.9 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +3 Query: 45 IIVLQYSNFITKCQIYHTEHLC 110 I+VL N++ K +++ +H+C Sbjct: 136 IMVLNDHNYVYKDSVFNPQHVC 157 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 4.9 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +3 Query: 45 IIVLQYSNFITKCQIYHTEHLC 110 I+VL N++ K +++ +H+C Sbjct: 150 IMVLNDHNYVYKDSVFNPQHVC 171 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 4.9 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +3 Query: 45 IIVLQYSNFITKCQIYHTEHLC 110 I+VL N++ K +++ +H+C Sbjct: 150 IMVLNDHNYVYKDSVFNPQHVC 171 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.0 bits (47), Expect = 4.9 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +2 Query: 32 KVSYNNCFTVQQFYNKMSDLPYGAPVRISPLIKFGRWSFLTVGVLYG 172 +V YN FT+ +D GA I + F WS LT+G+L G Sbjct: 724 EVLYNMVFTI----GLRNDSYVGA---IMIWLVFWPWSVLTIGILVG 763 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 22.6 bits (46), Expect = 6.5 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = +2 Query: 197 KKEAKLREIEAKEKVIRDAKLKEEKER 277 +KE +LRE +E+ ++ + KE++E+ Sbjct: 469 EKERELREQREREQREKEQREKEQREK 495 Score = 22.2 bits (45), Expect = 8.6 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 200 KEAKLREIEAKEKVIRDAKLKEEKER 277 +E + RE KE+ ++ + KEE+ER Sbjct: 475 REQREREQREKEQREKEQREKEERER 500 >AY752899-1|AAV30073.1| 43|Anopheles gambiae peroxidase 5B protein. Length = 43 Score = 22.2 bits (45), Expect = 8.6 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +2 Query: 161 VLYGAF--HQNRLSKKEAKLREIEAKEKVIRDAK 256 +L+ AF NRL+++ K R + EKV ++A+ Sbjct: 5 ILHVAFLREHNRLAQQLCKARPLWNDEKVFQEAR 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 418,261 Number of Sequences: 2352 Number of extensions: 7285 Number of successful extensions: 22 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -