BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10j04 (582 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 3.8 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 5.1 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 239 AKKSTTTGTLLLITFSLKSSVLWIFTMSFFDAVREK 132 A+ T G + SLK+ +LW F F +V K Sbjct: 94 AEHFTALGNFYFVHESLKNVLLWDFQECTFISVNGK 129 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -2 Query: 245 HVAKKSTTTGTLLLITFSLKSSVLWI 168 H + STT TL ++ ++ LW+ Sbjct: 242 HYSMNSTTYVTLTIVLMTMTLMTLWL 267 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,177 Number of Sequences: 438 Number of extensions: 2690 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -