BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10j04 (582 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 81 4e-16 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 78 5e-15 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 77 7e-15 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 74 6e-14 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 74 8e-14 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 72 2e-13 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 69 2e-12 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 69 2e-12 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 69 2e-12 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 69 2e-12 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 68 4e-12 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 68 4e-12 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 68 4e-12 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 68 5e-12 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 67 9e-12 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 66 2e-11 At4g12170.1 68417.m01934 thioredoxin family protein similar to S... 65 3e-11 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 64 9e-11 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 62 3e-10 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 61 5e-10 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 61 5e-10 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 61 6e-10 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 59 2e-09 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 58 6e-09 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 57 7e-09 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 57 7e-09 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 57 1e-08 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 57 1e-08 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 56 1e-08 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 55 3e-08 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 53 1e-07 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 50 1e-06 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 50 1e-06 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 50 1e-06 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 48 5e-06 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 48 6e-06 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 47 8e-06 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 47 1e-05 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 46 1e-05 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 46 2e-05 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 45 3e-05 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 45 4e-05 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 44 7e-05 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 44 7e-05 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 44 7e-05 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 44 7e-05 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 44 7e-05 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 42 4e-04 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 37 0.009 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 37 0.009 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 37 0.009 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 34 0.060 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 33 0.11 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 33 0.11 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 33 0.14 At3g50960.1 68416.m05580 expressed protein 32 0.24 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 31 0.74 At5g66410.1 68418.m08376 expressed protein 30 0.98 At2g31840.1 68415.m03888 expressed protein 30 0.98 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 29 2.3 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 29 2.3 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 29 2.3 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 29 3.0 At4g31240.2 68417.m04435 expressed protein 28 4.0 At4g31240.1 68417.m04434 expressed protein 28 4.0 At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / po... 27 6.9 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 27 6.9 At4g39050.1 68417.m05531 kinesin-related protein (MKRP2) kinesin... 27 9.1 At4g16130.1 68417.m02444 GHMP kinase family protein contains GHM... 27 9.1 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 81.4 bits (192), Expect = 4e-16 Identities = 35/102 (34%), Positives = 61/102 (59%) Frame = +1 Query: 175 STDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLA 354 S +++ KV+ S VPV+V+F+A WC PCR++ P ++ + + GK K++ DE + A Sbjct: 92 SDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTA 151 Query: 355 LDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASE 480 Y + SVP ++ K G+ ++ ++G + L K IE+F E Sbjct: 152 NRYGIRSVPTVIIFKGGEKKDSIIGAVPRETLEKTIERFLVE 193 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 77.8 bits (183), Expect = 5e-15 Identities = 34/100 (34%), Positives = 59/100 (59%) Frame = +1 Query: 166 KIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQT 345 K Q+ + F + + NS PV+VDF+ATWC PC+L+ P L + K + + K+D ++ Sbjct: 61 KKQTFNSFDDLLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYP 120 Query: 346 DLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIE 465 LA Y++ ++P + K+GK+ +R G ++L + IE Sbjct: 121 SLANKYQIEALPTFILFKDGKLWDRFEGALPANQLVERIE 160 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 77.4 bits (182), Expect = 7e-15 Identities = 32/100 (32%), Positives = 59/100 (59%) Frame = +1 Query: 166 KIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQT 345 K Q+ D F++ ++NS PV+VD++ATWC PC+ + P L + K K+ + K+D ++ Sbjct: 66 KKQTFDSFEDLLVNSDKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYP 125 Query: 346 DLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIE 465 +A Y++ ++P + K+G+ +R G +L + IE Sbjct: 126 SIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLIQRIE 165 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 74.1 bits (174), Expect = 6e-14 Identities = 43/127 (33%), Positives = 66/127 (51%) Frame = +1 Query: 121 FLRNFSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAES 300 F R +L S + ++++ + +FK KV+NS V+V+FFA WC C+ LTP E + + Sbjct: 17 FDRGNALYGSSSPVLQL-TPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL 75 Query: 301 KGKVVLAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASE 480 KG +A +D D ++ DY V P + GK G +D K I QFA + Sbjct: 76 KGIATVAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDA----KSISQFAIK 131 Query: 481 ETKAEIK 501 + KA +K Sbjct: 132 QIKALLK 138 Score = 51.6 bits (118), Expect = 4e-07 Identities = 24/78 (30%), Positives = 39/78 (50%) Frame = +1 Query: 175 STDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLA 354 ++ +F E V SK +V+FFA WC C+ L P + KGKV L V+ D + + Sbjct: 169 NSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVNCDAEQSIK 228 Query: 355 LDYEVSSVPVLVAIKNGK 408 ++V P ++ + K Sbjct: 229 SRFKVQGFPTILVFGSDK 246 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 73.7 bits (173), Expect = 8e-14 Identities = 41/122 (33%), Positives = 67/122 (54%), Gaps = 3/122 (2%) Frame = +1 Query: 127 RNFSLTASKNDIVKIQSTDDFKEKVINSKVP---VVVDFFATWCNPCRLLTPRLESIIAE 297 R + +++ I ST + + K +K +++ F ATWC PCR ++P L S +A Sbjct: 261 REAQAALNDGEVISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSP-LYSNLAT 319 Query: 298 SKGKVVLAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFAS 477 +VV KVDID+ D+A + +SSVP I++GK +++VG D L + I Q +S Sbjct: 320 QHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVG-ADKGSLEQKIAQHSS 378 Query: 478 EE 483 + Sbjct: 379 SK 380 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 72.1 bits (169), Expect = 2e-13 Identities = 35/105 (33%), Positives = 57/105 (54%) Frame = +1 Query: 163 VKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQ 342 V + + D+F E V N+ +V+F+A WC C+ LTP + E KG LAK+D E+ Sbjct: 101 VAVLTKDNFTEFVGNNSF-AMVEFYAPWCGACQALTPEYAAAATELKGLAALAKIDATEE 159 Query: 343 TDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFAS 477 DLA YE+ P + +G+++ G + D + W+++ AS Sbjct: 160 GDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKAS 204 Score = 35.5 bits (78), Expect = 0.026 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 2/92 (2%) Frame = +1 Query: 61 LTKNITNLFIRNCTLKKNYGFLRNFSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFA 240 LT N + K F ++ L + + VK+ ++F E V++ V+++ +A Sbjct: 405 LTVNNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYA 464 Query: 241 TWCNPCRLLTPRLESIIAESKG--KVVLAKVD 330 WC C+ P + KG +V+AK+D Sbjct: 465 PWCGHCQSFEPIYNKLGKYLKGIDSLVVAKMD 496 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 69.3 bits (162), Expect = 2e-12 Identities = 32/98 (32%), Positives = 59/98 (60%), Gaps = 3/98 (3%) Frame = +1 Query: 145 ASKNDIVKIQSTDDFKEKVI---NSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVV 315 A++ +++ + +D+ EK+ SK +V+DF ATWC PCR + P + A+ VV Sbjct: 2 AAEGEVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADL-AKKHLDVV 60 Query: 316 LAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVG 429 KVD+DE +A +++V ++P + +K G+++ +VG Sbjct: 61 FFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVG 98 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 69.3 bits (162), Expect = 2e-12 Identities = 41/126 (32%), Positives = 63/126 (50%), Gaps = 1/126 (0%) Frame = +1 Query: 115 YGFLR-NFSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESII 291 +GF + +L S + +V++ +++ FK KV+NS V+V+FFA WC C+ LTP E + Sbjct: 16 FGFFDLSSALYGSSSPVVQLTASN-FKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVA 74 Query: 292 AESKGKVVLAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQF 471 KG +A +D D A DY + P + GK G +D K I F Sbjct: 75 NILKGVATVAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDA----KSIANF 130 Query: 472 ASEETK 489 A ++ K Sbjct: 131 AYKQIK 136 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/72 (29%), Positives = 36/72 (50%) Frame = +1 Query: 175 STDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLA 354 + +F + VI S +V+FFA WC C+ L P + +GKV L V+ D + + Sbjct: 168 NASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVNCDVEQSIM 227 Query: 355 LDYEVSSVPVLV 390 ++V P ++ Sbjct: 228 SRFKVQGFPTIL 239 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 69.3 bits (162), Expect = 2e-12 Identities = 39/110 (35%), Positives = 62/110 (56%), Gaps = 3/110 (2%) Frame = +1 Query: 148 SKNDIVKIQSTDDFK---EKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVL 318 S +V+I+S +K + + S +V+DF A WC PC+ + PR+ IA + V Sbjct: 19 SNGFVVEIESRRQWKSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVRE-IASKYSEAVF 77 Query: 319 AKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQ 468 A+VD+D D+A Y ++P V +K G+ +R+VG + D+L K IEQ Sbjct: 78 ARVDVDRLMDVAGTYRAITLPAFVFVKRGEEIDRVVGAK-PDELVKKIEQ 126 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 68.9 bits (161), Expect = 2e-12 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 2/103 (1%) Frame = +1 Query: 163 VKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQ 342 +K +F V+ S PV+V+F ATWC PC+L+ P +E++ E K+ + K+D D Sbjct: 71 IKEIGESEFSSTVLESAQPVLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDAN 130 Query: 343 TDLALDYEVSSVPVLVAIKNGK--VQNRLVGLQDTDKLRKWIE 465 L +++V +P + K+GK +R G KL+++I+ Sbjct: 131 PKLIAEFKVYGLPHFILFKDGKEVPGSRREGAITKAKLKEYID 173 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 68.1 bits (159), Expect = 4e-12 Identities = 30/83 (36%), Positives = 53/83 (63%) Frame = +1 Query: 220 VVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLALDYEVSSVPVLVAIK 399 +VVDF A+WC PCR++ P + ++ A+ V K+D+DE D+A ++ V+++P V +K Sbjct: 50 LVVDFSASWCGPCRMIEPAIHAM-ADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVK 108 Query: 400 NGKVQNRLVGLQDTDKLRKWIEQ 468 GK R++G + D+L K + + Sbjct: 109 RGKEIERIIGAK-KDELEKKVSK 130 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 68.1 bits (159), Expect = 4e-12 Identities = 33/98 (33%), Positives = 58/98 (59%) Frame = +1 Query: 169 IQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTD 348 +++ ++ +K SK VVVDF A+WC PCR + P +A+ V+ KVD DE Sbjct: 14 VETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFAD-LAKKLPNVLFLKVDTDELKS 72 Query: 349 LALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWI 462 +A D+ + ++P + +K GK+ +++VG + D+L+ I Sbjct: 73 VASDWAIQAMPTFMFLKEGKILDKVVGAK-KDELQSTI 109 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 68.1 bits (159), Expect = 4e-12 Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = +1 Query: 160 IVKIQSTDDFKEKVINS-KVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDID 336 +VK S + +E V KVP++VDF+ATWC PC L+ LE + E + ++ KVD D Sbjct: 76 LVKKLSAQELQELVKGDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTD 135 Query: 337 EQTDLALDYEVSSVPVLVAI 396 ++ + A D +V +P L I Sbjct: 136 DEYEFARDMQVRGLPTLFFI 155 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 67.7 bits (158), Expect = 5e-12 Identities = 30/91 (32%), Positives = 50/91 (54%) Frame = +1 Query: 193 EKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLALDYEVS 372 +K S +V+DF A+WC PCR++ P + + + KVD+DE +A ++ V Sbjct: 22 DKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQSVAKEFGVE 81 Query: 373 SVPVLVAIKNGKVQNRLVGLQDTDKLRKWIE 465 ++P V IK G+V ++LVG D K ++ Sbjct: 82 AMPTFVFIKAGEVVDKLVGANKEDLQAKIVK 112 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 66.9 bits (156), Expect = 9e-12 Identities = 25/81 (30%), Positives = 52/81 (64%) Frame = +1 Query: 187 FKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLALDYE 366 +++ V+ S+ PV+V+F+ +WC PCR++ ++ I + GK+ ++ D +A +YE Sbjct: 76 WEDSVLKSETPVLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYE 135 Query: 367 VSSVPVLVAIKNGKVQNRLVG 429 + +VPV++ KNG+ + ++G Sbjct: 136 IKAVPVVLLFKNGEKRESIMG 156 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 65.7 bits (153), Expect = 2e-11 Identities = 32/98 (32%), Positives = 58/98 (59%), Gaps = 3/98 (3%) Frame = +1 Query: 145 ASKNDIVKIQSTDDFKEKVIN---SKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVV 315 A + +++ + + + EKV + SK +V+DF A+WC PCR + P + A+ VV Sbjct: 2 AGEGEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEM-AKKFTNVV 60 Query: 316 LAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVG 429 K+D+DE +A +++V ++P V +K G + +R+VG Sbjct: 61 FFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVG 98 >At4g12170.1 68417.m01934 thioredoxin family protein similar to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 128 Score = 65.3 bits (152), Expect = 3e-11 Identities = 33/94 (35%), Positives = 52/94 (55%) Frame = +1 Query: 148 SKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKV 327 S + +V+ S ++ VI SKVPV+V F A C C L P LE + +E + + V Sbjct: 21 SHDGLVQSLSASEWNSLVIQSKVPVIVVFIAKDCAECGSLMPELEFLDSEYEYMLKFYTV 80 Query: 328 DIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVG 429 D DE+ +LA DY + P+ + K G+ + R++G Sbjct: 81 DTDEELELAKDYRIEYHPITIVFKGGEEKERVLG 114 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 63.7 bits (148), Expect = 9e-11 Identities = 26/103 (25%), Positives = 54/103 (52%) Frame = +1 Query: 163 VKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQ 342 +++ + + V+ + PVVVDF+A WC PC+++ P + + GK+ K++ DE Sbjct: 82 IQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDES 141 Query: 343 TDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQF 471 + Y V S+P ++ G+ ++ ++G L +++F Sbjct: 142 PNTPGQYGVRSIPTIMIFVGGEKKDTIIGAVPKTTLTSSLDKF 184 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/91 (29%), Positives = 48/91 (52%) Frame = +1 Query: 199 VINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLALDYEVSSV 378 V+ + PV VDF+A WC PC+++ P + + + G+ K++ DE Y V S+ Sbjct: 88 VLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATPGQYGVRSI 147 Query: 379 PVLVAIKNGKVQNRLVGLQDTDKLRKWIEQF 471 P ++ NG+ ++ ++G D L I +F Sbjct: 148 PTIMIFVNGEKKDTIIGAVSKDTLATSINKF 178 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 61.3 bits (142), Expect = 5e-10 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 3/128 (2%) Frame = +1 Query: 115 YGFLRNFSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIA 294 + L ++A +D+V + TDD EK + +V+F+A WC C+ L P E + A Sbjct: 10 FALLALLLVSAVADDVVVL--TDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYEKLGA 67 Query: 295 ESK--GKVVLAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQ-NRLVGLQDTDKLRKWIE 465 K V++AKVD DEQ + Y VS P + G ++ + G ++ + L +++ Sbjct: 68 SFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVN 127 Query: 466 QFASEETK 489 + K Sbjct: 128 KEGGTNVK 135 Score = 56.8 bits (131), Expect = 1e-08 Identities = 37/128 (28%), Positives = 64/128 (50%), Gaps = 5/128 (3%) Frame = +1 Query: 130 NFSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESI--IAESK 303 N L A ++V + + D+F E V++ V+V+F+A WC C+ L P E + + + + Sbjct: 133 NVKLAAVPQNVV-VLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQE 191 Query: 304 GKVVLAKVDIDEQTDLALDYEVSSVPVLVAI-KNGKVQNRLVGLQDTDKLRKWIEQFA-- 474 VV+A +D D L Y VS P L K+ K + G +D D +I + + Sbjct: 192 EGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGT 251 Query: 475 SEETKAEI 498 S ++K ++ Sbjct: 252 SRDSKGQL 259 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 61.3 bits (142), Expect = 5e-10 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 3/128 (2%) Frame = +1 Query: 115 YGFLRNFSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIA 294 + L ++A +D+V + TDD EK + +V+F+A WC C+ L P E + A Sbjct: 10 FALLALLLVSAVADDVVVL--TDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYEKLGA 67 Query: 295 ESK--GKVVLAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQ-NRLVGLQDTDKLRKWIE 465 K V++AKVD DEQ + Y VS P + G ++ + G ++ + L +++ Sbjct: 68 SFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVN 127 Query: 466 QFASEETK 489 + K Sbjct: 128 KEGGTNVK 135 Score = 56.8 bits (131), Expect = 1e-08 Identities = 37/128 (28%), Positives = 64/128 (50%), Gaps = 5/128 (3%) Frame = +1 Query: 130 NFSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESI--IAESK 303 N L A ++V + + D+F E V++ V+V+F+A WC C+ L P E + + + + Sbjct: 133 NVKLAAVPQNVV-VLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQE 191 Query: 304 GKVVLAKVDIDEQTDLALDYEVSSVPVLVAI-KNGKVQNRLVGLQDTDKLRKWIEQFA-- 474 VV+A +D D L Y VS P L K+ K + G +D D +I + + Sbjct: 192 EGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGT 251 Query: 475 SEETKAEI 498 S ++K ++ Sbjct: 252 SRDSKGQL 259 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 60.9 bits (141), Expect = 6e-10 Identities = 32/110 (29%), Positives = 65/110 (59%), Gaps = 6/110 (5%) Frame = +1 Query: 160 IVKIQSTDDFKEKVINSKVP---VVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVD 330 IV+I++ + +K ++ K +V++F A WC PC+ L P+LE + A+ V K+D Sbjct: 39 IVEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYT-DVEFVKID 97 Query: 331 IDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTD---KLRKWIEQF 471 +D + +++ +S++P +V +K G+ + +VG++ + KL K+ + F Sbjct: 98 VDVLMSVWMEFNLSTLPAIVFMKRGREVDMVVGVKVDELERKLNKYTQSF 147 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 58.8 bits (136), Expect = 2e-09 Identities = 31/108 (28%), Positives = 61/108 (56%), Gaps = 3/108 (2%) Frame = +1 Query: 169 IQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLES---IIAESKGKVVLAKVDIDE 339 ++ TD + I++ + VDF+A WC C+ L P L++ I+A+ K +V+AK++ D+ Sbjct: 35 LELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAKLNADK 94 Query: 340 QTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASEE 483 + LA E+ + P L+ +G V G + D L +++++F + + Sbjct: 95 YSRLARKIEIDAFPTLMLYNHG-VPMEYYGPRKADLLVRYLKKFVAPD 141 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 57.6 bits (133), Expect = 6e-09 Identities = 27/95 (28%), Positives = 49/95 (51%) Frame = +1 Query: 172 QSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDL 351 +S DD + VV +F ATWC PC+++ P + +E ++ VD+DE +D Sbjct: 32 ESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIEL-SEKHSSLMFLLVDVDELSDF 90 Query: 352 ALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRK 456 + +++ + P +KNG+ +LVG + +K Sbjct: 91 SSSWDIKATPTFFFLKNGQQIGKLVGANKPELQKK 125 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 57.2 bits (132), Expect = 7e-09 Identities = 39/127 (30%), Positives = 66/127 (51%), Gaps = 6/127 (4%) Frame = +1 Query: 142 TASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLE---SIIAESKGKV 312 T +K ++ + T+ F + IN +VV+F+A WC C+ L P E S ++ + V Sbjct: 26 TETKEFVLTLDHTN-FTD-TINKHDFIVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPV 83 Query: 313 VLAKVDIDEQT--DLALDYEVSSVPVLVAIKN-GKVQNRLVGLQDTDKLRKWIEQFASEE 483 VLAK+D E+T + A YEV P + +N GK G ++ + + ++++ S Sbjct: 84 VLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKK-QSGP 142 Query: 484 TKAEIKA 504 AEIK+ Sbjct: 143 ASAEIKS 149 Score = 50.0 bits (114), Expect = 1e-06 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 2/85 (2%) Frame = +1 Query: 139 LTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIA--ESKGKV 312 + A N+ VK+ +D + V+NS V+++F+A WC C+ L P L+ + +S V Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSV 427 Query: 313 VLAKVDIDEQTDLALDYEVSSVPVL 387 V+AK+D ++V P + Sbjct: 428 VIAKLDATANDFPKDTFDVKGFPTI 452 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 57.2 bits (132), Expect = 7e-09 Identities = 39/127 (30%), Positives = 66/127 (51%), Gaps = 6/127 (4%) Frame = +1 Query: 142 TASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLE---SIIAESKGKV 312 T +K ++ + T+ F + IN +VV+F+A WC C+ L P E S ++ + V Sbjct: 26 TETKEFVLTLDHTN-FTD-TINKHDFIVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPV 83 Query: 313 VLAKVDIDEQT--DLALDYEVSSVPVLVAIKN-GKVQNRLVGLQDTDKLRKWIEQFASEE 483 VLAK+D E+T + A YEV P + +N GK G ++ + + ++++ S Sbjct: 84 VLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKK-QSGP 142 Query: 484 TKAEIKA 504 AEIK+ Sbjct: 143 ASAEIKS 149 Score = 50.0 bits (114), Expect = 1e-06 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 2/85 (2%) Frame = +1 Query: 139 LTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIA--ESKGKV 312 + A N+ VK+ +D + V+NS V+++F+A WC C+ L P L+ + +S V Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSV 427 Query: 313 VLAKVDIDEQTDLALDYEVSSVPVL 387 V+AK+D ++V P + Sbjct: 428 VIAKLDATANDFPKDTFDVKGFPTI 452 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 56.8 bits (131), Expect = 1e-08 Identities = 32/107 (29%), Positives = 58/107 (54%), Gaps = 1/107 (0%) Frame = +1 Query: 151 KNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGK-VVLAKV 327 + D+V I+ + F + + N++ V+V+F+A WC C+ L P + E K VVLAK+ Sbjct: 102 EKDVVVIKERN-FTDVIENNQY-VLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKI 159 Query: 328 DIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQ 468 D E+ +LA +Y V P L+ +G+ G + + + W+++ Sbjct: 160 DATEENELAQEYRVQGFPTLLFFVDGE-HKPYTGGRTKETIVTWVKK 205 Score = 37.5 bits (83), Expect = 0.006 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 2/72 (2%) Frame = +1 Query: 121 FLRNFSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESII--A 294 F ++ + ++ VKI D+F E V++ V+++ +A WC C+ L P + Sbjct: 429 FYKSDPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHL 488 Query: 295 ESKGKVVLAKVD 330 S +V+ K+D Sbjct: 489 RSIDSLVITKMD 500 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 56.8 bits (131), Expect = 1e-08 Identities = 32/107 (29%), Positives = 58/107 (54%), Gaps = 1/107 (0%) Frame = +1 Query: 151 KNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGK-VVLAKV 327 + D+V I+ + F + + N++ V+V+F+A WC C+ L P + E K VVLAK+ Sbjct: 102 EKDVVVIKERN-FTDVIENNQY-VLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKI 159 Query: 328 DIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQ 468 D E+ +LA +Y V P L+ +G+ G + + + W+++ Sbjct: 160 DATEENELAQEYRVQGFPTLLFFVDGE-HKPYTGGRTKETIVTWVKK 205 Score = 37.9 bits (84), Expect = 0.005 Identities = 23/109 (21%), Positives = 47/109 (43%) Frame = +1 Query: 121 FLRNFSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAES 300 F ++ + ++ VKI D+F E V++ V+++ +A WC C+ L P + Sbjct: 429 FYKSDPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHL 488 Query: 301 KGKVVLAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDK 447 + L +D T+ + P ++ G + + + DTD+ Sbjct: 489 RSIDSLVITKMDGTTNEHPKAKAEGFPTILFFPAGNKTSEPITV-DTDR 536 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 56.4 bits (130), Expect = 1e-08 Identities = 32/116 (27%), Positives = 56/116 (48%), Gaps = 3/116 (2%) Frame = +1 Query: 160 IVKIQSTDDFK---EKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVD 330 +VKI S + + + N P+V F A WC P + E + K + L VD Sbjct: 4 VVKIDSAESWNFYVSQAKNQNCPIVAHFTALWCIPSVFMNSFFEELAFNYKDALFLI-VD 62 Query: 331 IDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASEETKAEI 498 +DE ++A EV ++P + +K+G ++LVG + D+++K ++ F I Sbjct: 63 VDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVG-ANPDEIKKRVDGFVQSSRVVHI 117 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 55.2 bits (127), Expect = 3e-08 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 5/116 (4%) Frame = +1 Query: 136 SLTASKNDIVKIQSTDDF---KEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKG 306 S +N +V ++S ++F K + +P V F A WC PCR ++P + +++ Sbjct: 78 SEAGGENGVVLVKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVE-LSKQYP 136 Query: 307 KVVLAKVDIDEQ--TDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQ 468 V KVDIDE ++ +++VP L K G + +VG D KL+ +EQ Sbjct: 137 DVTTYKVDIDEGGISNTISKLNITAVPTLHFFKGGSKKGEVVG-ADVTKLKNLMEQ 191 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 53.2 bits (122), Expect = 1e-07 Identities = 27/91 (29%), Positives = 49/91 (53%), Gaps = 1/91 (1%) Frame = +1 Query: 202 INSKVP-VVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLALDYEVSSV 378 +NS+ P V+V F A WC PCR + P L + +E K + V+ D + +++S + Sbjct: 223 LNSQTPHVMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDISYL 282 Query: 379 PVLVAIKNGKVQNRLVGLQDTDKLRKWIEQF 471 P + K G+ ++ G D KLR+ ++++ Sbjct: 283 PTTLVFKGGEQMAKVTG-ADPKKLRELVKKY 312 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 50.0 bits (114), Expect = 1e-06 Identities = 27/105 (25%), Positives = 59/105 (56%), Gaps = 3/105 (2%) Frame = +1 Query: 151 KNDIVKIQSTDDFKEKVI--NSKVPV-VVDFFATWCNPCRLLTPRLESIIAESKGKVVLA 321 K + + + ++EK+ NS + VV+F A+WC P + + P + + A + ++ Sbjct: 39 KGKVHPVSRMEKWEEKITEANSHGKILVVNFKASWCLPSKTILPIYQEL-ASTYTSMIFV 97 Query: 322 KVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRK 456 +D++E + + ++ V + P +V +K+G+ ++LVG D +L+K Sbjct: 98 TIDVEELAEFSHEWNVDATPTVVFLKDGRQMDKLVG-GDAAELQK 141 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 50.0 bits (114), Expect = 1e-06 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 5/111 (4%) Frame = +1 Query: 151 KNDIVKIQSTDDFKE---KVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLA 321 ++ V ++S +F K + +P V F A WC PCRL++P + ++ V Sbjct: 48 RSSFVVLKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILE-LSNKYPDVTTY 106 Query: 322 KVDIDE--QTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQ 468 KVDIDE ++ VS+VP L K G + +VG+ D +L+ +EQ Sbjct: 107 KVDIDEGGLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGV-DVVRLKSVMEQ 156 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 49.6 bits (113), Expect = 1e-06 Identities = 32/119 (26%), Positives = 60/119 (50%) Frame = +1 Query: 139 LTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVL 318 ++ + DIV D+ ++ S PVV+ F+A+WC+ + + ++ S +A + Sbjct: 1 MSGTVKDIVSKAELDNLRQ----SGAPVVLHFWASWCDASKQMD-QVFSHLATDFPRAHF 55 Query: 319 AKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASEETKAE 495 +V+ +E +++ Y V++VP V K+GK + L G D L + + A T AE Sbjct: 56 FRVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEG-ADPSSLANKVGKVAGSSTSAE 113 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 48.0 bits (109), Expect = 5e-06 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 2/85 (2%) Frame = +1 Query: 220 VVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLALDYEVSSVPVLVAIK 399 V+VDF+ TWC CR + P+L A+ ++ KV+ DE L V +P + Sbjct: 116 VIVDFYGTWCGSCRAMFPKL-CKTAKEHPNILFLKVNFDENKSLCKSLNVKVLPYFHFYR 174 Query: 400 --NGKVQNRLVGLQDTDKLRKWIEQ 468 +G+V++ L KLR+ IE+ Sbjct: 175 GADGQVESFSCSLAKFQKLREAIER 199 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 47.6 bits (108), Expect = 6e-06 Identities = 21/73 (28%), Positives = 42/73 (57%) Frame = +1 Query: 238 ATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQN 417 A WC PC+ + P + A ++ VD++E + + ++ V + P +V +K+G+ + Sbjct: 17 APWCVPCKKIEPVFRDL-ASRYPSMIFVTVDVEELAEFSNEWNVEATPTVVFLKDGRQMD 75 Query: 418 RLVGLQDTDKLRK 456 +LVG +T +L+K Sbjct: 76 KLVG-AETSELQK 87 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 47.2 bits (107), Expect = 8e-06 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 5/67 (7%) Frame = +1 Query: 220 VVVDFFATWCNPCRLLTPRLESIIAESKG---KVVLAKVDIDEQT--DLALDYEVSSVPV 384 +VV+F+A WC C+ L P E +E + LAK+D E+ + A +Y++ P Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPT 108 Query: 385 LVAIKNG 405 L ++NG Sbjct: 109 LKILRNG 115 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 2/85 (2%) Frame = +1 Query: 139 LTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIA--ESKGKV 312 + A N+ VK+ + + V S V+++F+A WC C+ L P L+ + ++ V Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSV 425 Query: 313 VLAKVDIDEQTDLALDYEVSSVPVL 387 ++AK+D + ++V P + Sbjct: 426 IIAKLDATANDIPSDTFDVKGFPTI 450 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 1/76 (1%) Frame = +1 Query: 220 VVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDID-EQTDLALDYEVSSVPVLVAI 396 VV+D + WC PC+++ P+ ++ ++E VV K+D + + LA + + VP + Sbjct: 90 VVLDMYTQWCGPCKVIAPKYKA-LSEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTFKIL 148 Query: 397 KNGKVQNRLVGLQDTD 444 K+ KV + G + D Sbjct: 149 KDNKVVKEVTGAKYDD 164 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 1/86 (1%) Frame = +1 Query: 196 KVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQT-DLALDYEVS 372 K K+ VV+D + WC PC+++ P+ + ++E +V K+D ++ LA + + Sbjct: 93 KAAGDKI-VVLDMYTQWCGPCKVIAPKYKE-LSEKYQDMVFLKLDCNQDNKPLAKELGIR 150 Query: 373 SVPVLVAIKNGKVQNRLVGLQDTDKL 450 VP +K+ KV + G + D L Sbjct: 151 VVPTFKILKDNKVVKEVTGAKYEDLL 176 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 46.0 bits (104), Expect = 2e-05 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 3/91 (3%) Frame = +1 Query: 142 TASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRL---ESIIAESKGKV 312 T SK + ++ D+ ++VI+ V+V +A WC L PR + + E V Sbjct: 71 TVSKAQRIVLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSV 130 Query: 313 VLAKVDIDEQTDLALDYEVSSVPVLVAIKNG 405 ++AK+D D + +A + E+ P L+ NG Sbjct: 131 LMAKIDGDRYSKIASELEIKGFPTLLLFVNG 161 Score = 39.1 bits (87), Expect = 0.002 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 4/83 (4%) Frame = +1 Query: 187 FKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKG--KVVLAKVD--IDEQTDLA 354 F V+NS+ V+++ WC C L+ ++E + KG +V A++D +E T L Sbjct: 427 FDGLVLNSRENVLLEVHTPWCVNCEALSKQIEKLAKHFKGFENLVFARIDASANEHTKLQ 486 Query: 355 LDYEVSSVPVLVAIKNGKVQNRL 423 +D P+++ K+G+ + L Sbjct: 487 VD---DKYPIILLYKSGEKEKPL 506 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 45.2 bits (102), Expect = 3e-05 Identities = 30/120 (25%), Positives = 60/120 (50%) Frame = +1 Query: 139 LTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVL 318 ++ + DIV + D+ + +S P+V+ F+A+WC+ + + ++ S +A + Sbjct: 1 MSGTVKDIVSKEELDNLR----HSGAPLVLHFWASWCDASKQM-DQVFSHLATDFPRAHF 55 Query: 319 AKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASEETKAEI 498 +V+ +E +++ Y V+ VP V K+GK + L G D L + + A T A + Sbjct: 56 FRVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEG-ADPSSLANKVGKVAGSITPASL 114 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 44.8 bits (101), Expect = 4e-05 Identities = 28/118 (23%), Positives = 54/118 (45%), Gaps = 3/118 (2%) Frame = +1 Query: 142 TASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESK---GKV 312 T SK + ++ D +++I+ V+V +A WC L PR + K V Sbjct: 69 TVSKAQRIVVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATDLKEIGSSV 128 Query: 313 VLAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASEET 486 ++AK+D + + +A E+ P L+ NG Q+ G ++++ W+++ T Sbjct: 129 LMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGF-SSEEIVIWVQKKTGAST 185 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 44.0 bits (99), Expect = 7e-05 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 1/72 (1%) Frame = +1 Query: 217 PVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDE-QTDLALDYEVSSVPVLVA 393 P+++++ A+WC C L P+LE + AE + VD+++ L +S +P + Sbjct: 120 PIIIEWMASWCRKCIYLKPKLEKLAAEYNNRAKFYYVDVNKVPQTLVKRGNISKMPTIQL 179 Query: 394 IKNGKVQNRLVG 429 K +++ ++G Sbjct: 180 WKEDEMKEEVIG 191 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 44.0 bits (99), Expect = 7e-05 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 3/84 (3%) Frame = +1 Query: 187 FKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDE-QTDLALD- 360 ++E + N K P VV+F+A WC CR L P + I + K KV +++D + + LD Sbjct: 131 YEEALSNGK-PTVVEFYADWCEVCRELAPDVYKIEQQYKDKVNFVMLNVDNTKWEQELDE 189 Query: 361 YEVSSVPVLVAI-KNGKVQNRLVG 429 + V +P + + G + +VG Sbjct: 190 FGVEGIPHFAFLDREGNEEGNVVG 213 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 44.0 bits (99), Expect = 7e-05 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 1/76 (1%) Frame = +1 Query: 157 DIVKIQSTDDFKEKVINS-KVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDI 333 ++V I ST++F + + + V+V+F+ TWC CR L P+L E +V KV+ Sbjct: 104 NMVDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHP-DIVFLKVNF 162 Query: 334 DEQTDLALDYEVSSVP 381 DE + V +P Sbjct: 163 DENKPMCKSLNVRVLP 178 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 44.0 bits (99), Expect = 7e-05 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 1/76 (1%) Frame = +1 Query: 157 DIVKIQSTDDFKEKVINS-KVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDI 333 ++V I ST++F + + + V+V+F+ TWC CR L P+L E +V KV+ Sbjct: 104 NMVDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHP-DIVFLKVNF 162 Query: 334 DEQTDLALDYEVSSVP 381 DE + V +P Sbjct: 163 DENKPMCKSLNVRVLP 178 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 44.0 bits (99), Expect = 7e-05 Identities = 21/82 (25%), Positives = 42/82 (51%) Frame = +1 Query: 220 VVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLALDYEVSSVPVLVAIK 399 ++V + + C PCR L P L ++ E V ++DI+E ++A + P + K Sbjct: 445 ILVLYTSPTCGPCRTLKPILNKVVDEYNHDVHFVEIDIEEDQEIAEAAGIMGTPCVQFFK 504 Query: 400 NGKVQNRLVGLQDTDKLRKWIE 465 N ++ + G++ + R++IE Sbjct: 505 NKEMLRTISGVKMKKEYREFIE 526 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 41.5 bits (93), Expect = 4e-04 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 8/70 (11%) Frame = +1 Query: 220 VVVDFFATWCNPCRLLTPRLESIIAESK--------GKVVLAKVDIDEQTDLALDYEVSS 375 +VV+F+A WC C LL P E + K G+V+LAKVD ++ DL + Sbjct: 161 LVVNFYAPWCYWCNLLKPSWEKAAKQIKERYDPEMDGRVILAKVDCTQEGDLCRRNHIQG 220 Query: 376 VPVLVAIKNG 405 P + + G Sbjct: 221 YPSIRIFRKG 230 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 37.1 bits (82), Expect = 0.009 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = +1 Query: 220 VVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDE-QTDLALDYEVSSVPVLVAI 396 VV+ + A WC C L P+LE + AE ++ VD++ L V+ +P + Sbjct: 101 VVIVWMAAWCRKCIYLKPKLEKLAAEFYPRLRFYHVDVNAVPYRLVSRAGVTKMPTIQLW 160 Query: 397 KNGKVQNRLVG 429 ++G+ Q ++G Sbjct: 161 RDGQKQAEVIG 171 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 37.1 bits (82), Expect = 0.009 Identities = 29/106 (27%), Positives = 51/106 (48%), Gaps = 7/106 (6%) Frame = +1 Query: 190 KEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAES---KGKVVLAKVDI----DEQTD 348 K K NS V VVDF+ T C C+ + + +S + V+ K ++ DEQ++ Sbjct: 115 KSKETNSLV--VVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSE 172 Query: 349 LALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASEET 486 +A + +VP+ KNG V +D +++ I ++ S E+ Sbjct: 173 VAERLRIKAVPLFHFYKNG-VLLESFATRDKERIDAAILKYTSSES 217 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 37.1 bits (82), Expect = 0.009 Identities = 29/106 (27%), Positives = 51/106 (48%), Gaps = 7/106 (6%) Frame = +1 Query: 190 KEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAES---KGKVVLAKVDI----DEQTD 348 K K NS V VVDF+ T C C+ + + +S + V+ K ++ DEQ++ Sbjct: 102 KSKETNSLV--VVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSE 159 Query: 349 LALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASEET 486 +A + +VP+ KNG V +D +++ I ++ S E+ Sbjct: 160 VAERLRIKAVPLFHFYKNG-VLLESFATRDKERIDAAILKYTSSES 204 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 34.3 bits (75), Expect = 0.060 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = +1 Query: 220 VVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLALDYEVSSVP 381 VVVDFF+ C C+ L P++ IAE +V +V+ +E L + +P Sbjct: 116 VVVDFFSPSCGGCKALHPKI-CKIAEKNPEVEFLQVNYEEHRSLCQSLNIHVLP 168 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = +1 Query: 232 FFATWCNPCRLLTPRLESIIAESKGKV--VLAKVDIDEQTDLALDYEVSSVPVLVAIKNG 405 F A WC PC+ TP+L + E KV + V DE + DY + V + Sbjct: 50 FSAAWCGPCQRFTPQLVEVYNELSSKVGFEIVFVSGDEDEESFGDYFRKMPWLAVPFTDS 109 Query: 406 KVQNRL 423 + ++RL Sbjct: 110 ETRDRL 115 Score = 31.5 bits (68), Expect = 0.42 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 220 VVVDFFATWCNPCRLLTPRLESIIAESK 303 +++ F A WC PCR TP+L + + K Sbjct: 366 ILMYFSAHWCPPCRAFTPKLVEVYKQIK 393 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 33.5 bits (73), Expect = 0.11 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 1/78 (1%) Frame = +1 Query: 151 KNDIVKIQSTDDFKEKVINSKVP-VVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKV 327 K+++ +I S + + + N+ VVVDFF+ C C+ L P++ AE V +V Sbjct: 96 KDNMREISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKI-CQFAEMNPDVQFLQV 154 Query: 328 DIDEQTDLALDYEVSSVP 381 + +E + V +P Sbjct: 155 NYEEHKSMCYSLGVHVLP 172 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 33.1 bits (72), Expect = 0.14 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 9/64 (14%) Frame = +1 Query: 223 VVDFFATWCNPCRLLTPRLESII-------AESKGKVVLAKVDIDEQTDLAL--DYEVSS 375 VV+FFA WC CR P E + A G V++ +VD +T+ L + VS Sbjct: 58 VVEFFAHWCPACRNYKPHYEKVARLFNGPDAIHPGIVLMTRVDCAMKTNTKLCDKFSVSH 117 Query: 376 VPVL 387 P+L Sbjct: 118 YPML 121 >At3g50960.1 68416.m05580 expressed protein Length = 230 Score = 32.3 bits (70), Expect = 0.24 Identities = 22/88 (25%), Positives = 38/88 (43%) Frame = +1 Query: 175 STDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLA 354 S DF +V S+ V+ F+ C+++ L+++ A KVD + Sbjct: 90 SEGDFLGEVTRSE-KVICHFYHKEFYRCKIMDKHLKTL-APRHVDTKFIKVDAENAPFFV 147 Query: 355 LDYEVSSVPVLVAIKNGKVQNRLVGLQD 438 + ++P +V G +RLVG QD Sbjct: 148 TKLAIKTLPCVVLFSKGVAMDRLVGFQD 175 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 30.7 bits (66), Expect = 0.74 Identities = 22/90 (24%), Positives = 40/90 (44%) Frame = +1 Query: 157 DIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDID 336 ++ +I S + FK +N V+ F + C+ ++P ++S+ + KVDID Sbjct: 596 EVEEIYSLEQFKS-AMNLPGVSVIHFSTASDHQCKQISPFVDSLCTRYPS-IHFLKVDID 653 Query: 337 EQTDLALDYEVSSVPVLVAIKNGKVQNRLV 426 + + V VP + KNG +V Sbjct: 654 KCPSIGNAENVRVVPTVKIYKNGSRVKEIV 683 >At5g66410.1 68418.m08376 expressed protein Length = 230 Score = 30.3 bits (65), Expect = 0.98 Identities = 20/88 (22%), Positives = 38/88 (43%) Frame = +1 Query: 175 STDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDIDEQTDLA 354 S DF +V S+ V+ F+ C+++ L+++ A K+D + Sbjct: 90 SEGDFLGEVTRSE-KVICHFYHKEFYRCKIMDKHLKTL-APRHVDTKFIKMDAENAPFFV 147 Query: 355 LDYEVSSVPVLVAIKNGKVQNRLVGLQD 438 + ++P ++ G +RLVG QD Sbjct: 148 TKLAIKTLPCVILFSKGIAMDRLVGFQD 175 >At2g31840.1 68415.m03888 expressed protein Length = 350 Score = 30.3 bits (65), Expect = 0.98 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +1 Query: 325 VDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVGLQDTDKLRK 456 VD +TDL +VS P ++ K GK+ R G++ D+L K Sbjct: 274 VDAVVETDLVSALKVSVFPEIIFTKAGKILYREKGIRTADELSK 317 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 9/64 (14%) Frame = +1 Query: 223 VVDFFATWCNPCRLLTPRLESII-------AESKGKVVLAKVD--IDEQTDLALDYEVSS 375 V++FFA WC CR P E + A G V++ +VD I L + ++ Sbjct: 64 VLEFFAHWCPACRNYKPHYEKVARLFNGADAVYPGVVLMTRVDCAIKMNVKLCDKFSINH 123 Query: 376 VPVL 387 P+L Sbjct: 124 YPML 127 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 9/64 (14%) Frame = +1 Query: 223 VVDFFATWCNPCRLLTPRLESII-------AESKGKVVLAKVD--IDEQTDLALDYEVSS 375 V++FFA WC CR P E + A G V++ +VD I L + ++ Sbjct: 64 VLEFFAHWCPACRNYKPHYEKVARLFNGADAVYPGVVLMTRVDCAIKMNVKLCDKFSINH 123 Query: 376 VPVL 387 P+L Sbjct: 124 YPML 127 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 29.1 bits (62), Expect = 2.3 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 7/72 (9%) Frame = +1 Query: 190 KEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAES---KGKVVLAKVDI----DEQTD 348 K K NS V VVDF+ T C C+ + + +S + V+ K ++ DEQ++ Sbjct: 102 KSKETNSLV--VVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSE 159 Query: 349 LALDYEVSSVPV 384 +A + +P+ Sbjct: 160 VAERLRIKVIPL 171 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 28.7 bits (61), Expect = 3.0 Identities = 22/91 (24%), Positives = 38/91 (41%) Frame = +1 Query: 154 NDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGKVVLAKVDI 333 N++ + + D FK+ V V V F ++ C ++P + ++ V VD+ Sbjct: 587 NEVEAVSTLDKFKKSVALPGVSVF-HFKSSSNRQCEEISPFINTLCLRYP-LVHFFMVDV 644 Query: 334 DEQTDLALDYEVSSVPVLVAIKNGKVQNRLV 426 +E LA + VP KNG +V Sbjct: 645 EESMALAKAESIRKVPTFKMYKNGDKVKEMV 675 >At4g31240.2 68417.m04435 expressed protein Length = 392 Score = 28.3 bits (60), Expect = 4.0 Identities = 25/123 (20%), Positives = 52/123 (42%), Gaps = 2/123 (1%) Frame = +1 Query: 133 FSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGK- 309 +S+ A++ + + + + I+ K + + F A WC PC+ TP L + + + Sbjct: 18 YSILAAEGIEFLLSHSGEVPLEYIHGKT-ICLFFSAIWCRPCKDFTPELIKLYENLQNRG 76 Query: 310 VVLAKVDIDEQTDLALDYE-VSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASEET 486 L + + D+ YE +P L N + N+L ++ + ++ E + Sbjct: 77 EELEIIFVSFDHDMTSFYEHFWCMPWLAVPFNLSLLNKLRDKYGISRIPSLVPLYSDEIS 136 Query: 487 KAE 495 AE Sbjct: 137 VAE 139 >At4g31240.1 68417.m04434 expressed protein Length = 392 Score = 28.3 bits (60), Expect = 4.0 Identities = 25/123 (20%), Positives = 52/123 (42%), Gaps = 2/123 (1%) Frame = +1 Query: 133 FSLTASKNDIVKIQSTDDFKEKVINSKVPVVVDFFATWCNPCRLLTPRLESIIAESKGK- 309 +S+ A++ + + + + I+ K + + F A WC PC+ TP L + + + Sbjct: 18 YSILAAEGIEFLLSHSGEVPLEYIHGKT-ICLFFSAIWCRPCKDFTPELIKLYENLQNRG 76 Query: 310 VVLAKVDIDEQTDLALDYE-VSSVPVLVAIKNGKVQNRLVGLQDTDKLRKWIEQFASEET 486 L + + D+ YE +P L N + N+L ++ + ++ E + Sbjct: 77 EELEIIFVSFDHDMTSFYEHFWCMPWLAVPFNLSLLNKLRDKYGISRIPSLVPLYSDEIS 136 Query: 487 KAE 495 AE Sbjct: 137 VAE 139 >At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / potassium channel protein identical to SKOR [Arabidopsis thaliana] gi|3810676|emb|CAA11280; member of the 1 pore, 6 transmembrane (1P/6TM) Shaker K+ channel family, PMID:11500563 Length = 828 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 289 IAESKGKVVLAKVDIDEQTDLALDYEVSSVPVLVAIKNG 405 +A S+G + I E D+ + ++ S P+L AIKNG Sbjct: 587 LAASRGYEDITLYLIQESVDVNIKDKLGSTPLLEAIKNG 625 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 27.5 bits (58), Expect = 6.9 Identities = 27/111 (24%), Positives = 42/111 (37%), Gaps = 17/111 (15%) Frame = +1 Query: 220 VVVDFFATWCNPCRLLTP---RLESIIAE-----SKGKVVLAKVDIDEQTDLALDYEVSS 375 +VV+F+A WC L P + I E + +V+L VD E+ L + Sbjct: 162 LVVNFYAPWCYWSNRLKPSWVKASQITRERYNPGTDDRVLLGSVDCTEEPTLCKSNHIQG 221 Query: 376 VPVLVAIKNGK---------VQNRLVGLQDTDKLRKWIEQFASEETKAEIK 501 P + + G G +DTD L K +E+ K + K Sbjct: 222 YPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMVEELLKPIKKEDHK 272 >At4g39050.1 68417.m05531 kinesin-related protein (MKRP2) kinesin motor protein - Ustilago maydis, PID:g2062750; identical to cDNA MKRP2 mRNA for kinesin-related protein GI:16902293, kinesin-related protein [Arabidopsis thaliana] GI:16902294 Length = 1055 Score = 27.1 bits (57), Expect = 9.1 Identities = 28/118 (23%), Positives = 57/118 (48%), Gaps = 4/118 (3%) Frame = +1 Query: 61 LTKNITNLFIRNCTLKKNYGFLRNFSLTASKNDIVKIQSTDDFKEKVINS--KVPVVVDF 234 L ++ N+++ LKK+ G L + T ++ K QS KE+ ++S + P VV Sbjct: 908 LENDLANMWVLVAKLKKDNGALPEPNGTDPGRELEKSQSHAVLKERQVSSAPRQPEVVVV 967 Query: 235 FATWCNPC-RLLTPRLESIIAESKGKVVLAKVDIDEQTDLA-LDYEVSSVPVLVAIKN 402 T P L RL++ + E K K + ++ + D + + + +E + +L+ ++ Sbjct: 968 AKTEETPKEEPLVARLKARMQEMKEKEMKSQANGDANSHICKVCFESPTAAILLPCRH 1025 >At4g16130.1 68417.m02444 GHMP kinase family protein contains GHMP kinases putative ATP-binding protein domain, Pfam:PF00288 Length = 1039 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +1 Query: 277 LESIIAESKGKVVLAKVDIDEQTDLALDYEVSSVPVLVAIKNGKVQNRLVG 429 + S + E KG A V++ + +A + +S P +AI KV+N +VG Sbjct: 688 VSSAVPEGKGVSSSAAVEVASMSAIAAAHGLSIDPRDLAILCQKVENHIVG 738 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,354,964 Number of Sequences: 28952 Number of extensions: 210335 Number of successful extensions: 733 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -