BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10j02 (689 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 3.0 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 3.0 DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary ... 25 3.0 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 3.9 AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 23 6.9 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 23 6.9 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 23 9.1 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 23 9.1 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 23 9.1 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 23 9.1 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 23 9.1 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 24.6 bits (51), Expect = 3.0 Identities = 17/59 (28%), Positives = 22/59 (37%) Frame = +1 Query: 232 GKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFGTVKEAKAGTGATASVIYVPPP 408 G T H+ L K V + AGT L T + G+GA A+ P P Sbjct: 363 GASATPHNMPPLGSLCKTVSQIGQHVAGTGSLNGSGSATNGASNGGSGAPATAKPTPKP 421 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 24.6 bits (51), Expect = 3.0 Identities = 17/59 (28%), Positives = 22/59 (37%) Frame = +1 Query: 232 GKQGTFHSQQALDYGTKVVGGVSPKKAGTEHLGKPVFGTVKEAKAGTGATASVIYVPPP 408 G T H+ L K V + AGT L T + G+GA A+ P P Sbjct: 363 GASATPHNMPPLGSLCKTVSQIGQHVAGTGSLNGSGSATNGASNGGSGAPATAKPTPKP 421 >DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 99 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = -3 Query: 471 CNAHNEGHFSLNSF*NGCCSSRGRYINNRGSCSCACLC 358 C NE ++S S C++ + ++ G C C C Sbjct: 25 CTVENEEYYSCASPCRRNCTNLAQMLSCTGVCVSGCFC 62 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 24.2 bits (50), Expect = 3.9 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 15/51 (29%) Frame = +1 Query: 550 NCPGIIAPEKCKI-------GIMPAA--------VHKRGCIGVVSRSGTLT 657 NC ++AP KI G+ PA VHK+GC +VS +T Sbjct: 500 NCKDVLAPHLAKIFNLSLSLGVFPALWKSCWLFPVHKKGCRSIVSNYRGIT 550 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 23.4 bits (48), Expect = 6.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 603 SWHDTNFTLLGSNDTRT 553 SWH T+F LLG +++ Sbjct: 291 SWHGTDFQLLGYRGSKS 307 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.4 bits (48), Expect = 6.9 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 549 RTNQSRLVLSQEGMFYSHHIMLWHTFCNAHNEGH 448 RTN + +++ G SHH H N H GH Sbjct: 213 RTNNNNTIITDSGHMRSHH---QHYTAN-HQNGH 242 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 374 PVPAFASLTVPNTGLPRCSVPAFFGDT 294 P P +LT N G P C+ F DT Sbjct: 141 PPPCPPTLTTFNGGQPTCAGKLLFEDT 167 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 374 PVPAFASLTVPNTGLPRCSVPAFFGDT 294 P P +LT N G P C+ F DT Sbjct: 141 PPPCPPTLTTFNGGQPTCAGKLLFEDT 167 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 374 PVPAFASLTVPNTGLPRCSVPAFFGDT 294 P P +LT N G P C+ F DT Sbjct: 141 PPPCPPTLTTFNGGQPTCAGKLLFEDT 167 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 374 PVPAFASLTVPNTGLPRCSVPAFFGDT 294 P P +LT N G P C+ F DT Sbjct: 139 PPPCPPTLTTFNGGQPTCAGKLLFEDT 165 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 374 PVPAFASLTVPNTGLPRCSVPAFFGDT 294 P P +LT N G P C+ F DT Sbjct: 141 PPPCPPTLTTFNGGQPTCAGKLLFEDT 167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 759,407 Number of Sequences: 2352 Number of extensions: 15612 Number of successful extensions: 25 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -